Ovis aries (sheep): 101106504 Help Entry 101106504         CDS       T03117                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism oas  Ovis aries (sheep) Pathway oas04015   Rap1 signaling pathway oas04810   Regulation of actin cytoskeleton oas05014   Amyotrophic lateral sclerosis oas05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101106504 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101106504 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101106504 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101106504 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     101106504 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oas04812]     101106504 (PFN4)    04147 Exosome [BR:oas04147]     101106504 (PFN4) Membrane trafficking [BR:oas04131]  Others   Actin-binding proteins    Others     101106504 (PFN4) Cytoskeleton proteins [BR:oas04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101106504 (PFN4) Exosome [BR:oas04147]  Exosomal proteins   Proteins found in most exosomes    101106504 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101106504 NCBI-ProteinID:  XP_027822358 LinkDB All DBs Position 3:complement(31761679..31766619) Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIRLQERSLCVASPGFNVMPSDVRTLVNGFAKNPLKTR REGLYFKEKDYKCVRADDYSLYAKNENTGVIVVKTHLYLLVATYSEGMYPSVCVEATEKL GDYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatacactcctgggaacaaagcatgtggacagt gcagccctcatcagactccaggagcggagcctatgtgtagcatcaccaggatttaatgta atgcccagtgacgtccgaacacttgtaaatgggtttgccaaaaaccctttgaaaaccaga agagaaggattgtatttcaaggagaaggactacaaatgtgtccgggcagatgactattct ctttatgccaagaatgaaaacactggtgtgattgttgtgaagacccatctgtatcttctg gtggcaacttactctgaaggcatgtatcctagtgtctgtgtggaagccacagagaagttg ggagactatctaagaagaaaagggaattaa

DBGET integrated database retrieval system