Ovis aries (sheep): 101107228 Help Entry 101107228         CDS       T03117                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism oas  Ovis aries (sheep) Pathway oas04144   Endocytosis oas04510   Focal adhesion oas05020   Prion disease oas05100   Bacterial invasion of epithelial cells oas05205   Proteoglycans in cancer oas05410   Hypertrophic cardiomyopathy oas05412   Arrhythmogenic right ventricular cardiomyopathy oas05414   Dilated cardiomyopathy oas05416   Viral myocarditis oas05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101107228 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101107228 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101107228 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101107228 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     101107228 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101107228 (CAV3)    05410 Hypertrophic cardiomyopathy     101107228 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     101107228 (CAV3)    05414 Dilated cardiomyopathy     101107228 (CAV3)    05416 Viral myocarditis     101107228 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     101107228 (CAV3) Membrane trafficking [BR:oas04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     101107228 (CAV3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  101107228 NCBI-ProteinID:  XP_004018349 UniProt:  A0A6P3EN41 LinkDB All DBs Position 19:complement(17738687..17751264) Genome browser AA seq 151 aa AA seqDB search MMAEERTDLEAQIVKDIHFKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQVCSNIKVMLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatggccgaggagcgcacagacctggaggcccagatcgtcaaggacattcacttcaag gagatcgatctggtgaaccgggaccctaagaacatcaacgaggacatagtgaaggtggat tttgaagacgtgatcgcggagcccgtgggcacctacagctttgacggcgtgtggaaggtg agctacaccaccttcacggtctccaagtactggtgctaccgcctgctgtccacactgctg ggcgtcccactggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggcggtggtgccctgcatcaagagctacctgatcgagatccagtgcatcagccacatc tactcactctgcatccgcaccttctgcaacccactcttcgccgccctgggccaggtctgc agcaacatcaaggtgatgctgcggaaggaagtgtga

DBGET integrated database retrieval system