Ovis aries (sheep): 101107565 Help Entry 101107565         CDS       T03117                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism oas  Ovis aries (sheep) Pathway oas04810   Regulation of actin cytoskeleton oas05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oas00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101107565  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101107565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 LXG Motif Other DBs NCBI-GeneID:  101107565 NCBI-ProteinID:  XP_042098644 UniProt:  W5NVW5 LinkDB All DBs Position 1:196478740..196479085 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQQEIHQDWANREYIEVITSSIKKTANFLNSFDMSCRSRLATINEKLTALERR IEYIQTRVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggacaagaggatccagtgcagcaggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaaccgcaaactttctcaactcattcgat atgtcttgtcgctcaagactcgcaacaataaacgagaaactgacagctcttgaacggaga atagagtacatacaaaccagggtgacaaaaggtgaaaccctcacctag

DBGET integrated database retrieval system