Ovis aries (sheep): 101107565 Help Entry 101107565         CDS       T03117                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism oas  Ovis aries (sheep) Pathway oas04519   Cadherin signaling oas04810   Regulation of actin cytoskeleton oas05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04519 Cadherin signaling     101107565  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101107565  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101107565 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 LXG CLIP1 Motif Other DBs NCBI-GeneID:  101107565 NCBI-ProteinID:  XP_042098644 LinkDB All DBs Position 1:196478740..196479085 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQQEIHQDWANREYIEVITSSIKKTANFLNSFDMSCRSRLATINEKLTALERR IEYIQTRVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggacaagaggatccagtgcagcaggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaaccgcaaactttctcaactcattcgat atgtcttgtcgctcaagactcgcaacaataaacgagaaactgacagctcttgaacggaga atagagtacatacaaaccagggtgacaaaaggtgaaaccctcacctag

DBGET integrated database retrieval system