Ovis aries (sheep): 101110290 Help Entry 101110290         CDS       T03117                                  Symbol MRAS Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism oas  Ovis aries (sheep) Pathway oas04010   MAPK signaling pathway oas04014   Ras signaling pathway oas04015   Rap1 signaling pathway oas04072   Phospholipase D signaling pathway oas04137   Mitophagy - animal oas04140   Autophagy - animal oas04218   Cellular senescence oas04371   Apelin signaling pathway oas04625   C-type lectin receptor signaling pathway oas04810   Regulation of actin cytoskeleton oas05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101110290 (MRAS)    04014 Ras signaling pathway     101110290 (MRAS)    04015 Rap1 signaling pathway     101110290 (MRAS)    04371 Apelin signaling pathway     101110290 (MRAS)    04072 Phospholipase D signaling pathway     101110290 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101110290 (MRAS)    04137 Mitophagy - animal     101110290 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     101110290 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101110290 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101110290 (MRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101110290 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:oas04031]     101110290 (MRAS) GTP-binding proteins [BR:oas04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101110290 (MRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  101110290 NCBI-ProteinID:  XP_004003353 UniProt:  A0A836A1J5 LinkDB All DBs Position 1:complement(251356048..251423365) Genome browser AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcaacgagtgcagtccccagcgacaacctccccacgtacaagctggtggtggtggga gatgggggtgtgggcaagagcgccctcaccatccagtttttccagaagatctttgtgcct gactacgaccccaccatcgaagactcctacctgaaacatacagagattgacaatcagtgg gccatcttggacgttctggacacggccggacaggaggagttcagcgccatgcgggagcag tacatgcgcacgggggacggcttcctcatcgtcttctcggtcacggacaaggccagtttc gagcacgtggaccgcttccaccagctcatcctgcgcgtcaaggacagggagtcattcccg atgatcctcgtggccaacaaggtcgatctgatgcatttgaggaaaatcaccagggagcaa ggaaaagaaatggcgaccaaacacaatattccgtacatagaaaccagtgccaaggaccca cctctcaacgtcgacaaagccttccacgacctggttagagtaattaggcagcagattcca gaaaaaagccagaagaagaagaagaaaaccaaatggcggggagaccgggccacgggcacc cacaaactgcagtgtgtgatattgtga

DBGET integrated database retrieval system