KEGG   Ovis aries (sheep): 101111039
Entry
101111039         CDS       T03117                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
oas  Ovis aries (sheep)
Pathway
oas04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101111039 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oas04050]
    101111039 (TNFRSF8)
   04090 CD molecules [BR:oas04090]
    101111039 (TNFRSF8)
Cytokine receptors [BR:oas04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101111039 (TNFRSF8)
CD molecules [BR:oas04090]
 Proteins
  101111039 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 101111039
NCBI-ProteinID: XP_027831869
Ensembl: ENSOARG00000017371
UniProt: A0A6P7ENG2
LinkDB
Position
12:complement(44924289..44962140)
AA seq 486 aa
MFCGTSVVNSCARCIPHSVCPAGMVVKLQGTAQRDTVCEPASPRASHNCSASPQDCKGPT
SGAIPQAKPTLTSPASPGARTMLLGGDIPLTPEDASKMTPNSSSFVVKLNPDPGLTLQPP
CPWGSADCRKQCNHDYYLDRDGRCKACVTCSGDGLVEKTPCTWNSSRVCECQPGMFCATP
VTNSCARCVTRPNCPPGMVTKLQGMAETSTTYEPPGLGSPPDCNTSPEDRGAPTSPTPSL
VSLADSLTGKEHEAGVTHAWEDTPVSTSAPISFSSTGKPALVSGPVLFWVILILVVVVSF
SSFVLCHRRACRKWIGQKLHLCYPVQTFRPTLEPVDSKPGRNPILTKSVSVADPGNEEQG
LLSRPAVETCLESLRLLEANPVSSPPSPTDLPEPRGTMEHTNNRIENIYIMKADTVIVGT
VKAEVPEGQGPMGPARPELEEELETDYASHYPEQETEPPLGSCGDVMFSVEEEGKEDPLP
TTVSEK
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgttctgtggcacgtcagtcgtcaactcctgtgcccgctgcatcccccactctgtctgc
ccggcaggaatggttgtcaagttgcagggcacagcacagagggacaccgtctgtgaacca
gcttccccaagggccagccacaactgcagcgccagcccacaggactgcaagggccccacc
agtggcgccatcccccaggccaagcccaccctgacctccccagcaagccctggtgccagg
accatgcttcttggaggggacatccccctcaccccagaagatgcttctaaaatgactccc
aactccagctccttcgtggtgaagctcaatccagatccagggctgaccctgcagccccca
tgcccttgggggtctgctgactgcaggaagcagtgtaaccacgactactacctggacagg
gacggtcgctgcaaggcctgtgtgacatgttcaggagatggcctcgtggagaagacacct
tgcacatggaactcttcccgagtctgtgagtgtcaacctggcatgttctgtgccacgcca
gtcaccaattcctgtgcccgctgcgtcacccgccccaactgcccaccagggatggtcacc
aagctccagggtatggctgagacaagcaccacctatgagccacctggactggggagccct
cctgactgcaacaccagcccagaggaccgtggggcgcctaccagccccaccccctccttg
gtctccctggctgactccctgaccggtaaggagcatgaagcgggtgtcacccacgcctgg
gaggacaccccagtctcaaccagtgctcccatctccttctcctccacgggaaagccggct
ctggtttcaggacctgtgctcttctgggtgattctgatactggtggtggtcgtcagcttc
agctccttcgttctgtgccaccggagggcctgcaggaagtggattggacagaagctgcat
ctgtgctacccagtccagaccttccggcccacgctggagcctgtggattccaagccgggg
aggaacccgatactgaccaaaagtgtatcagtggcagacccaggcaatgaggagcagggc
ttactgagtcgcccggctgtggagacctgcctggagagcctgcggctgctggaggccaac
ccagtcagcagccccccgtcccccacagacctacctgagccccgagggaccatggagcat
accaacaacaggattgagaacatctacatcatgaaagccgacaccgtgattgtggggacc
gtgaaggccgaggtgcctgagggccaaggcccaatggggccagccaggcctgagctcgag
gaggagctggagacggactatgcctcccactacccagagcaggagacagagccaccgctg
ggcagctgtggggacgttatgttctcagtggaggaggaagggaaggaggaccccttgccc
acgactgtctctgagaaatga

DBGET integrated database retrieval system