Ovis aries (sheep): 101111303 Help Entry 101111303         CDS       T03117                                  Name (RefSeq) C-C motif chemokine 18-like   KO K05408   C-C motif chemokine 3 Organism oas  Ovis aries (sheep) Pathway oas04060   Cytokine-cytokine receptor interaction oas04061   Viral protein interaction with cytokine and cytokine receptor oas04062   Chemokine signaling pathway oas04620   Toll-like receptor signaling pathway oas05142   Chagas disease oas05163   Human cytomegalovirus infection oas05323   Rheumatoid arthritis oas05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101111303    04061 Viral protein interaction with cytokine and cytokine receptor     101111303  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101111303    04062 Chemokine signaling pathway     101111303  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     101111303   09174 Infectious disease: parasitic    05142 Chagas disease     101111303   09163 Immune disease    05323 Rheumatoid arthritis     101111303   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101111303  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     101111303    00536 Glycosaminoglycan binding proteins [BR:oas00536]     101111303 Cytokines and neuropeptides [BR:oas04052]  Cytokines   Chemokines    101111303 Glycosaminoglycan binding proteins [BR:oas00536]  Heparan sulfate / Heparin   Chemokines    101111303 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CRIM1_C CR_prot_dom_plant Motif Other DBs NCBI-GeneID:  101111303 NCBI-ProteinID:  XP_027831289 LinkDB All DBs Position 11:14112823..14127794 Genome browser AA seq 139 aa AA seqDB search MSVGLPQKIQPSPGHLEREDSSHPRRRQAEVSSQASSQLCPQSSACLSSIMKVLVAAVFV LCAVALCSCAQKKVYTPPTCCFTYASGKIPQGNVVNYFKTSSDCPKPGIIFLTRKGRYVC VNPADSWVQKYIRDLKKSP NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgtcagtcgggctcccacaaaaaatacagcccagcccagggcatctagaaagagaagac agctcacatcccagaaggagacaagcagaagtgagttcccaagcctcttctcagctctgc ccacagtcttctgcctgcctgtccagcatcatgaaggtcctcgtggctgctgtctttgtc ctctgcgctgtggccctctgctcctgtgcacaaaaaaaggtttacaccccacccacttgc tgcttcacctacgcctccgggaaaatcccccaaggaaatgtggttaactattttaagacc agcagcgactgccccaaacctggtatcatcttcctcaccagaaagggccgatacgtctgt gtcaatcctgctgacagctgggtccagaaatacatcagggacctgaagaagagcccctga

DBGET integrated database retrieval system