Ovis aries (sheep): 101115553 Help Entry 101115553         CDS       T03117                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism oas  Ovis aries (sheep) Pathway oas04060   Cytokine-cytokine receptor interaction oas04061   Viral protein interaction with cytokine and cytokine receptor oas04062   Chemokine signaling pathway oas04620   Toll-like receptor signaling pathway oas04621   NOD-like receptor signaling pathway oas04623   Cytosolic DNA-sensing pathway oas04668   TNF signaling pathway oas05020   Prion disease oas05142   Chagas disease oas05163   Human cytomegalovirus infection oas05164   Influenza A oas05168   Herpes simplex virus 1 infection oas05323   Rheumatoid arthritis oas05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     101115553 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101115553 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     101115553 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101115553 (CCL5)    04621 NOD-like receptor signaling pathway     101115553 (CCL5)    04623 Cytosolic DNA-sensing pathway     101115553 (CCL5)    04062 Chemokine signaling pathway     101115553 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     101115553 (CCL5)    05168 Herpes simplex virus 1 infection     101115553 (CCL5)    05163 Human cytomegalovirus infection     101115553 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     101115553 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     101115553 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     101115553 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101115553 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     101115553 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:oas00536]     101115553 (CCL5) Cytokines and neuropeptides [BR:oas04052]  Cytokines   Chemokines    101115553 (CCL5) Glycosaminoglycan binding proteins [BR:oas00536]  Heparan sulfate / Heparin   Chemokines    101115553 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 DUF4148 Motif Other DBs NCBI-GeneID:  101115553 NCBI-ProteinID:  XP_027831106 LinkDB All DBs Position 11:14238105..14244850 Genome browser AA seq 91 aa AA seqDB search MKVFSAALAVLLMAAALCAPASASPYASDTTPCCFAYLSRPLPRNHVQEYFYTSSKCSMA AVVFITRKNRQVCANPEKKWVREYINSLELS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcttctccgctgccctcgctgtcctcctgatggcggccgccctctgcgctcct gcgtctgcctccccatatgcctcggacaccacgccctgctgctttgcctacctctcccgc ccgctgccccgcaaccacgtccaggaatatttctacaccagcagcaagtgctccatggca gcagttgtctttatcaccaggaagaaccgtcaggtgtgcgccaacccagagaagaagtgg gttcgagagtacatcaacagtttggagttgagctag

DBGET integrated database retrieval system