Ovis aries (sheep): 101119679 Help Entry 101119679         CDS       T03117                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism oas  Ovis aries (sheep) Pathway oas04613   Neutrophil extracellular trap formation oas05034   Alcoholism oas05203   Viral carcinogenesis oas05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oas00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101119679  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101119679   09163 Immune disease    05322 Systemic lupus erythematosus     101119679   09165 Substance dependence    05034 Alcoholism     101119679  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oas03036]     101119679   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     101119679 Chromosome and associated proteins [BR:oas03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101119679 Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101119679 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101119679 NCBI-ProteinID:  XP_004019079 UniProt:  A0A836CTR2 A0A6P3EJI1 LinkDB All DBs Position 20:29971078..29971550 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagccaagtccgctccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg ggcatcatgaattcgttcgtgaacgatattttcgagcgcatcgcgggcgaggcgtcgcgc ctggctcattacaacaagcgctcgaccatcacatccagggagatccagacggctgtgcgc ctgctgcttcccggagaactggccaagcacgccgtgtctgagggcaccaaggccgtcacc aagtataccagctccaagtga

DBGET integrated database retrieval system