Ovis aries (sheep): 101122039 Help Entry 101122039         CDS       T03117                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism oas  Ovis aries (sheep) Pathway oas04014   Ras signaling pathway oas04137   Mitophagy - animal oas04144   Endocytosis oas04145   Phagosome oas04148   Efferocytosis oas04962   Vasopressin-regulated water reabsorption oas05132   Salmonella infection oas05146   Amoebiasis oas05152   Tuberculosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101122039 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101122039 (RAB5C)    04145 Phagosome     101122039 (RAB5C)    04137 Mitophagy - animal     101122039 (RAB5C)    04148 Efferocytosis     101122039 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     101122039 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101122039 (RAB5C)    05152 Tuberculosis     101122039 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     101122039 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     101122039 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     101122039 (RAB5C)    04031 GTP-binding proteins [BR:oas04031]     101122039 (RAB5C) Membrane trafficking [BR:oas04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     101122039 (RAB5C)  Endosome - Lysosome transport     101122039 (RAB5C) Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101122039 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    101122039 (RAB5C)   Exosomal proteins of colorectal cancer cells    101122039 (RAB5C)   Exosomal proteins of bladder cancer cells    101122039 (RAB5C) GTP-binding proteins [BR:oas04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     101122039 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  101122039 NCBI-ProteinID:  XP_027830311 UniProt:  W5QBQ8 LinkDB All DBs Position 11:complement(41990220..42012188) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggcgcagcacgacccaacggaccagctgctgggaacaagatctgt cagtttaagctggtcctgctgggggagtccgcggtgggcaaatccagcctcgtcctccgc ttcgtcaagggtcagttccacgagtaccaggagagcacaattggagcggccttcctcaca cagaccgtctgcttggacgacacaacagtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tacgacatcaccaacacagatacctttgcacgggccaagaactgggtgaaggagttgcag aggcaggccagccccaacatcgtcattgcgctcgcaggcaacaaggcggacctggccagc aagagagccgtggagttccaggaagcacaagcctatgcagaggacaacagtttgctgttc atggagacatcagcaaagactgcgatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaacgaaccccagaatgcagctggtgctccaggccggaaccgaggcgtg gacctccaggagaacaaccccgccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system