KEGG   Ovis aries (sheep): 101122881
Entry
101122881         CDS       T03117                                 
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
oas  Ovis aries (sheep)
Pathway
oas03050  Proteasome
oas05010  Alzheimer disease
oas05012  Parkinson disease
oas05014  Amyotrophic lateral sclerosis
oas05016  Huntington disease
oas05017  Spinocerebellar ataxia
oas05020  Prion disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101122881 (PSMD7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101122881 (PSMD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101122881 (PSMD7)
   05012 Parkinson disease
    101122881 (PSMD7)
   05014 Amyotrophic lateral sclerosis
    101122881 (PSMD7)
   05016 Huntington disease
    101122881 (PSMD7)
   05017 Spinocerebellar ataxia
    101122881 (PSMD7)
   05020 Prion disease
    101122881 (PSMD7)
   05022 Pathways of neurodegeneration - multiple diseases
    101122881 (PSMD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:oas03051]
    101122881 (PSMD7)
Proteasome [BR:oas03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101122881 (PSMD7)
SSDB
Motif
Pfam: MitMem_reg JAB Connexin
Other DBs
NCBI-GeneID: 101122881
NCBI-ProteinID: XP_004015155
UniProt: A0A6P3EL50 W5P0D5
LinkDB
Position
14:complement(36535961..36544431)
AA seq 322 aa
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRGYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEDSKKDR
KDDKEKEKEKSDVKKEEKKEKK
NT seq 969 nt   +upstreamnt  +downstreamnt
atgccggagctggcggtgcagaaggtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaatcgaataggcaaggttggaaaccaaaaacgtgttgttggtgtgcttttg
gggtcatggcaaaagaaagtactcgatgtatccaacagttttgcagttccttttgatgaa
gacgacaaagatgattctgtctggtttttagaccatgattacttggaaaacatgtatgga
atgtttaagaaggtaaacgccagagaaagaatagttgggtggtaccacacaggccctaaa
ctacacaagaatgacatcgccatcaatgaactcatgaaaagatactgccctaactcagta
ttggtcatcattgatgtgaaaccaaaggacctgggactgcccacagaagcatatatttcg
gtggaagaagttcatgatgatggaactccaacctcaaagacatttgagcacgtaaccagt
gaaatcggagcagaggaagctgaggaagtcggagttgaacacttattacgagacatcaaa
gacactacagtgggcactctttcccagcggatcacaaaccaggtccatggtctgaaggga
ctcaactccaagctcctggacatcaggggctacctggagaaggtggccaccggcaagctg
cccatcaaccaccagatcatctaccagctgcaggacgtcttcaacctgctgccagatgtc
agcctgcaggagtttgtcaaggccttttacctgaagaccaacgatcagatggtggtagta
tatttggcctcactgatccgttctgtggttgccttgcacaacctcatcaacaacaagatt
gccaaccgggacgcagaaaagaaagaagggcaagaaaaggaagacagcaaaaaggacaga
aaagacgacaaagagaaagagaaggaaaagagtgatgtaaagaaagaagagaaaaaggag
aaaaaataa

DBGET integrated database retrieval system