Ovis aries (sheep): 101123141 Help Entry 101123141         CDS       T03117                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism oas  Ovis aries (sheep) Pathway oas04060   Cytokine-cytokine receptor interaction oas04061   Viral protein interaction with cytokine and cytokine receptor oas04062   Chemokine signaling pathway oas04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101123141 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     101123141 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101123141 (CCL22)    04062 Chemokine signaling pathway     101123141 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     101123141 (CCL22) Cytokines and neuropeptides [BR:oas04052]  Cytokines   Chemokines    101123141 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  101123141 NCBI-ProteinID:  XP_004015071 UniProt:  W5NPF7 LinkDB All DBs Position 14:24943609..24951691 Genome browser AA seq 93 aa AA seqDB search MASLQTPLLAALILLAMTLQATEAGPYGANVEDSVCCRDYIRYPLPLRLVKYYYWTSNSC RRPGVVLLTVKDREICADPKQHWVKKILQKLNQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgcagacccctctcctggctgctctcatcctcctggctatgacacttcaa gcaacagaggcaggcccctacggtgccaacgtggaggacagcgtctgttgccgggactac atccgttaccctctgcccctgcgtttggtgaaatattactactggacttcaaattcctgc cggaggcctggcgtggtcttgctgaccgtgaaggaccgagagatctgtgctgaccccaaa cagcactgggtgaagaagattctccagaagctgaaccaatga

DBGET integrated database retrieval system