Ovis aries (sheep): 105601948 Help Entry 105601948         CDS       T03117                                  Name (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism oas  Ovis aries (sheep) Pathway oas04060   Cytokine-cytokine receptor interaction oas04151   PI3K-Akt signaling pathway oas04217   Necroptosis oas04620   Toll-like receptor signaling pathway oas04621   NOD-like receptor signaling pathway oas04622   RIG-I-like receptor signaling pathway oas04623   Cytosolic DNA-sensing pathway oas04630   JAK-STAT signaling pathway oas04650   Natural killer cell mediated cytotoxicity oas04936   Alcoholic liver disease oas05152   Tuberculosis oas05160   Hepatitis C oas05161   Hepatitis B oas05162   Measles oas05163   Human cytomegalovirus infection oas05164   Influenza A oas05165   Human papillomavirus infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05168   Herpes simplex virus 1 infection oas05169   Epstein-Barr virus infection oas05170   Human immunodeficiency virus 1 infection oas05171   Coronavirus disease - COVID-19 oas05200   Pathways in cancer oas05320   Autoimmune thyroid disease oas05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105601948    04151 PI3K-Akt signaling pathway     105601948   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105601948  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105601948  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105601948    04621 NOD-like receptor signaling pathway     105601948    04622 RIG-I-like receptor signaling pathway     105601948    04623 Cytosolic DNA-sensing pathway     105601948    04650 Natural killer cell mediated cytotoxicity     105601948  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105601948   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105601948    05161 Hepatitis B     105601948    05160 Hepatitis C     105601948    05171 Coronavirus disease - COVID-19     105601948    05164 Influenza A     105601948    05162 Measles     105601948    05168 Herpes simplex virus 1 infection     105601948    05163 Human cytomegalovirus infection     105601948    05167 Kaposi sarcoma-associated herpesvirus infection     105601948    05169 Epstein-Barr virus infection     105601948    05165 Human papillomavirus infection     105601948   09171 Infectious disease: bacterial    05152 Tuberculosis     105601948   09163 Immune disease    05320 Autoimmune thyroid disease     105601948   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105601948   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105601948  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     105601948 Cytokines and neuropeptides [BR:oas04052]  Cytokines   Interferons    105601948 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  105601948 NCBI-ProteinID:  XP_014948276 LinkDB All DBs Position 2:89959664..89960275 Genome browser AA seq 189 aa AA seqDB search MAAAWSLLLALLLLSCNAICSRGCHLPHTHSLANRRVLTLLQQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDRSLLDKLRTTLDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRITLYLQEKGHSPCAWEVVRAEVMRAFSSSTN LQERFRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccgcagcctggtccttactcctggccctgctgctgctcagctgtaacgccatctgc tctcggggctgccacctgcctcacacccacagcctggccaacaggagggtcctgacgctc ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcgtgg gaccggagcctcctggacaagctccgcaccacactggatcagcagctcactgacctgcaa gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagaatcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagcaaggactga

DBGET integrated database retrieval system