KEGG   Ovis aries (sheep): 105609272
Entry
105609272         CDS       T03117                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X3
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
oas  Ovis aries (sheep)
Pathway
oas04927  Cortisol synthesis and secretion
oas04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:oas00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    105609272 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105609272 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ T4SS_pilin
Other DBs
NCBI-GeneID: 105609272
NCBI-ProteinID: XP_012041776
Ensembl: ENSOARG00000013792
UniProt: A0A6P3TX99
LinkDB
Position
1:complement(131393281..131410677)
AA seq 167 aa
MANRTNTSAPYYSYEYYLDYLDLMPVDEKKLSANKHSIAIAFWVSLAAFVVFLFLILLYM
SWSGSPQTRNATQEPPTCPWSLGLNLPLYVWRQPQHPRPPPGDPAASTELGRGTRRRSIP
ACPAAATRETLHLGAPRTTLLSSGNWPSVGTYRAPADVSNTPSEPPL
NT seq 504 nt   +upstreamnt  +downstreamnt
atggccaacagaaccaacacctctgccccatactacagctacgaatactacctggactac
ttggacctcatgcccgtggatgagaagaagctaagcgccaacaaacactcgatcgccatc
gccttctgggtgagcctggcagctttcgtggtttttctcttcctcatccttctctacatg
tcctggtcaggctctccacagacgaggaacgccacccaggagcccccaacatgtccctgg
agtcttggcctcaacctcccgctctacgtctggaggcaaccccagcaccccaggcccccc
ccgggggaccctgcagcctccaccgagctcggtcgaggaaccagacgccggagcatcccg
gcctgtccagcagctgcaacgagagagaccctccacctcggcgcccccaggactaccctg
ctctcctctgggaactggccctcggtggggacctacagggcaccagctgacgtcagcaac
acgcccagtgagcctcccctgtag

DBGET integrated database retrieval system