Ovis aries (sheep): 105613048 Help Entry 105613048         CDS       T03117                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X3   KO K05759   profilin Organism oas  Ovis aries (sheep) Pathway oas04015   Rap1 signaling pathway oas04810   Regulation of actin cytoskeleton oas05014   Amyotrophic lateral sclerosis oas05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105613048 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105613048 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105613048 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105613048 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     105613048 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oas04812]     105613048 (PFN2)    04147 Exosome [BR:oas04147]     105613048 (PFN2) Membrane trafficking [BR:oas04131]  Others   Actin-binding proteins    Others     105613048 (PFN2) Cytoskeleton proteins [BR:oas04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105613048 (PFN2) Exosome [BR:oas04147]  Exosomal proteins   Proteins found in most exosomes    105613048 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105613048 NCBI-ProteinID:  XP_014948092 LinkDB All DBs Position 1:238934509..238940889 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaatggtttgactcttggtgcaaagaagtgctcagtgatcagagatagcctatacgtg gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgccgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system