KEGG   Ovis aries (sheep): 105614854
Entry
105614854         CDS       T03117                                 
Name
(RefSeq) calmodulin-alpha
  KO
K02183  calmodulin
Organism
oas  Ovis aries (sheep)
Pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04070  Phosphatidylinositol signaling system
oas04114  Oocyte meiosis
oas04218  Cellular senescence
oas04261  Adrenergic signaling in cardiomyocytes
oas04270  Vascular smooth muscle contraction
oas04371  Apelin signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04713  Circadian entrainment
oas04720  Long-term potentiation
oas04722  Neurotrophin signaling pathway
oas04728  Dopaminergic synapse
oas04740  Olfactory transduction
oas04744  Phototransduction
oas04750  Inflammatory mediator regulation of TRP channels
oas04910  Insulin signaling pathway
oas04912  GnRH signaling pathway
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04921  Oxytocin signaling pathway
oas04922  Glucagon signaling pathway
oas04924  Renin secretion
oas04925  Aldosterone synthesis and secretion
oas04970  Salivary secretion
oas04971  Gastric acid secretion
oas05010  Alzheimer disease
oas05012  Parkinson disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05031  Amphetamine addiction
oas05034  Alcoholism
oas05133  Pertussis
oas05152  Tuberculosis
oas05163  Human cytomegalovirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05214  Glioma
oas05417  Lipid and atherosclerosis
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    105614854
   04015 Rap1 signaling pathway
    105614854
   04371 Apelin signaling pathway
    105614854
   04020 Calcium signaling pathway
    105614854
   04070 Phosphatidylinositol signaling system
    105614854
   04024 cAMP signaling pathway
    105614854
   04022 cGMP-PKG signaling pathway
    105614854
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    105614854
   04218 Cellular senescence
    105614854
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105614854
  09152 Endocrine system
   04910 Insulin signaling pathway
    105614854
   04922 Glucagon signaling pathway
    105614854
   04912 GnRH signaling pathway
    105614854
   04915 Estrogen signaling pathway
    105614854
   04921 Oxytocin signaling pathway
    105614854
   04916 Melanogenesis
    105614854
   04924 Renin secretion
    105614854
   04925 Aldosterone synthesis and secretion
    105614854
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105614854
   04270 Vascular smooth muscle contraction
    105614854
  09154 Digestive system
   04970 Salivary secretion
    105614854
   04971 Gastric acid secretion
    105614854
  09156 Nervous system
   04728 Dopaminergic synapse
    105614854
   04720 Long-term potentiation
    105614854
   04722 Neurotrophin signaling pathway
    105614854
  09157 Sensory system
   04744 Phototransduction
    105614854
   04740 Olfactory transduction
    105614854
   04750 Inflammatory mediator regulation of TRP channels
    105614854
  09159 Environmental adaptation
   04713 Circadian entrainment
    105614854
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105614854
  09162 Cancer: specific types
   05214 Glioma
    105614854
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105614854
   05163 Human cytomegalovirus infection
    105614854
   05167 Kaposi sarcoma-associated herpesvirus infection
    105614854
  09171 Infectious disease: bacterial
   05133 Pertussis
    105614854
   05152 Tuberculosis
    105614854
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105614854
   05012 Parkinson disease
    105614854
   05022 Pathways of neurodegeneration - multiple diseases
    105614854
  09165 Substance dependence
   05031 Amphetamine addiction
    105614854
   05034 Alcoholism
    105614854
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105614854
   05418 Fluid shear stress and atherosclerosis
    105614854
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oas01009]
    105614854
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    105614854
   03036 Chromosome and associated proteins [BR:oas03036]
    105614854
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    105614854
Protein phosphatases and associated proteins [BR:oas01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     105614854
Membrane trafficking [BR:oas04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    105614854
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     105614854
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   105614854
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 EF-hand_11 Dockerin_1 EFhand_Ca_insen Caleosin FCaBP_EF-hand DUF1103 Poly_export TerB SPEF2_C PhageMin_Tail Fe_hyd_lg_C PA_Ig-like DUF5580_M
Other DBs
NCBI-GeneID: 105614854
NCBI-ProteinID: XP_012030881
UniProt: A0A6P3TQP7 W5QJ98
LinkDB
Position
3:209204899..209205970
AA seq 145 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFAYL
NT seq 438 nt   +upstreamnt  +downstreamnt
atggctgaccagctgactgaagagcagattgcagaattcaaagaagctttttcactattt
gacaaggatggtgatggaactataacaacaaaggaattgggaactgtaatgcggtctctt
gggcagaatcccacagaagcagagttacaggacatgattaatgaagtagatgctgatggt
aatggcacaattgacttcccggaatttctgacaatgatggcaagaaaaatgaaagataca
gacagtgaagaagaaattagagaagcattccgtgtgtttgataaggatggtaatggctat
attagtgcagcagagctccgccatgtgatgacaaaccttggagagaagttaacagatgaa
gaggttgatgaaatgatcagggaagcagatattgatggtgatggtcaagtaaactatgaa
gagtttgcttatctgtaa

DBGET integrated database retrieval system