Ovis aries (sheep): 105614945 Help Entry 105614945         CDS       T03117                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism oas  Ovis aries (sheep) Pathway oas03010   Ribosome oas04120   Ubiquitin mediated proteolysis oas04137   Mitophagy - animal oas04140   Autophagy - animal oas05012   Parkinson disease oas05022   Pathways of neurodegeneration - multiple diseases oas05167   Kaposi sarcoma-associated herpesvirus infection oas05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:oas00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     105614945   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105614945  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105614945    04137 Mitophagy - animal     105614945  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     105614945    05167 Kaposi sarcoma-associated herpesvirus infection     105614945   09164 Neurodegenerative disease    05012 Parkinson disease     105614945    05022 Pathways of neurodegeneration - multiple diseases     105614945  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:oas03011]     105614945    04121 Ubiquitin system [BR:oas04121]     105614945   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     105614945 Ribosome [BR:oas03011]  Ribosomal proteins   Eukaryotes    Small subunit     105614945   Archaea     105614945 Ubiquitin system [BR:oas04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    105614945 Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105614945   Exosomal proteins of colorectal cancer cells    105614945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ribosomal_S27 Ubiquitin_5 Ubiquitin_2 Dsc3_N Rad60-SLD_2 TBK1_ULD DUF2604 HATPase_c Motif Other DBs NCBI-GeneID:  105614945 NCBI-ProteinID:  XP_027824248 LinkDB All DBs Position 4:10714166..10714671 Genome browser AA seq 149 aa AA seqDB search MQISVKTLTGKTITLEVKLSDTTENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLRLVLRLRGGAMKRKESYTTPKKNKPKRKKLKLAVLKYYKVDENGKISRLRREY PSDECGAGVFMASHLLLSHFSRVRLCATP NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgcagatttccgtgaagaccctgacggggaagacgatcactcttgaggtcaagctctcg gatacaacagaaaatgtaaaggccaagatccaggataaggaaggaattcctcctgaccag caaagactgatctttgctggcaagcaactggaagacggacgtactttgtctgactacaac attcaaaaggagtccactcttcgtctagtgttgagacttcgtggtggtgctatgaaaagg aaggagtcttacaccactcccaagaagaacaagcctaagagaaagaagcttaaactggct gttctgaaatactataaggtggatgagaatggcaaaatcagtcgccttcgccgggagtat ccctcagatgaatgtggtgctggagtttttatggccagtcacttactactaagtcacttc agtcgtgtccgactctgtgcgaccccatag

DBGET integrated database retrieval system