Ovis aries (sheep): 114109364 Help Entry 114109364         CDS       T03117                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism oas  Ovis aries (sheep) Pathway oas04613   Neutrophil extracellular trap formation oas05034   Alcoholism oas05202   Transcriptional misregulation in cancer oas05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oas00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114109364  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     114109364   09163 Immune disease    05322 Systemic lupus erythematosus     114109364   09165 Substance dependence    05034 Alcoholism     114109364  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oas03036]     114109364   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     114109364 Chromosome and associated proteins [BR:oas03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114109364 Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114109364 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S YebU_pre-PUA_dom CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  114109364 NCBI-ProteinID:  XP_027813729 LinkDB All DBs Position 18:complement(67802131..67802691) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHHYRPGTVALREIRLYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTSLCAIHAKRVTI MPKDIQLARCIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcaccgaggaagcaa ctcgctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cattacaggcctggtactgtggcactccgtgaaattagactttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgggaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccagcctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgctgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system