Ovis aries (sheep): 114110121 Help Entry 114110121         CDS       T03117                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism oas  Ovis aries (sheep) Pathway oas04010   MAPK signaling pathway oas04014   Ras signaling pathway oas04015   Rap1 signaling pathway oas04022   cGMP-PKG signaling pathway oas04066   HIF-1 signaling pathway oas04068   FoxO signaling pathway oas04072   Phospholipase D signaling pathway oas04081   Hormone signaling oas04114   Oocyte meiosis oas04140   Autophagy - animal oas04150   mTOR signaling pathway oas04151   PI3K-Akt signaling pathway oas04152   AMPK signaling pathway oas04211   Longevity regulating pathway oas04213   Longevity regulating pathway - multiple species oas04810   Regulation of actin cytoskeleton oas04910   Insulin signaling pathway oas04911   Insulin secretion oas04913   Ovarian steroidogenesis oas04914   Progesterone-mediated oocyte maturation oas04917   Prolactin signaling pathway oas04923   Regulation of lipolysis in adipocytes oas04930   Type II diabetes mellitus oas04931   Insulin resistance oas04932   Non-alcoholic fatty liver disease oas04940   Type I diabetes mellitus oas04950   Maturity onset diabetes of the young oas04960   Aldosterone-regulated sodium reabsorption oas05010   Alzheimer disease oas05215   Prostate cancer oas05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114110121 (INS)    04014 Ras signaling pathway     114110121 (INS)    04015 Rap1 signaling pathway     114110121 (INS)    04066 HIF-1 signaling pathway     114110121 (INS)    04068 FoxO signaling pathway     114110121 (INS)    04072 Phospholipase D signaling pathway     114110121 (INS)    04022 cGMP-PKG signaling pathway     114110121 (INS)    04151 PI3K-Akt signaling pathway     114110121 (INS)    04152 AMPK signaling pathway     114110121 (INS)    04150 mTOR signaling pathway     114110121 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     114110121 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114110121 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     114110121 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     114110121 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     114110121 (INS)    04910 Insulin signaling pathway     114110121 (INS)    04923 Regulation of lipolysis in adipocytes     114110121 (INS)    04913 Ovarian steroidogenesis     114110121 (INS)    04914 Progesterone-mediated oocyte maturation     114110121 (INS)    04917 Prolactin signaling pathway     114110121 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     114110121 (INS)   09149 Aging    04211 Longevity regulating pathway     114110121 (INS)    04213 Longevity regulating pathway - multiple species     114110121 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     114110121 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     114110121 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     114110121 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     114110121 (INS)    04940 Type I diabetes mellitus     114110121 (INS)    04950 Maturity onset diabetes of the young     114110121 (INS)    04932 Non-alcoholic fatty liver disease     114110121 (INS)    04931 Insulin resistance     114110121 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     114110121 (INS) Cytokines and neuropeptides [BR:oas04052]  Neuropeptides   Unclassified    114110121 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  114110121 NCBI-ProteinID:  XP_027815630 LinkDB All DBs Position 21:45772821..45774090 Genome browser AA seq 105 aa AA seqDB search MALWTRLVPLLALLALWAPAPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG PQVGALELAGGPGAGGLEGPPQKRGIVEQCCAGVCSLYQLENYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacacgcctggtgcccctgctggccctgctggcgctctgggcccccgcc ccggcccgcgccttcgtcaaccagcacctgtgcggctcccacctggtggaggcgctgtac ctggtgtgcggagagcgcggcttcttctacacgcccaaggcccgccgggaggtggagggc ccccaggtgggggcgctggagctggccggaggccccggcgcgggcggcctggaggggccc ccgcagaagcgtggcatcgtggagcagtgctgcgccggcgtctgctctctctaccagctg gagaactactgtaactag

DBGET integrated database retrieval system