Ovis aries (sheep): 114113187 Help Entry 114113187         CDS       T03117                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism oas  Ovis aries (sheep) Pathway oas04613   Neutrophil extracellular trap formation oas05034   Alcoholism oas05203   Viral carcinogenesis oas05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oas00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114113187  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     114113187   09163 Immune disease    05322 Systemic lupus erythematosus     114113187   09165 Substance dependence    05034 Alcoholism     114113187  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oas03036]     114113187 Chromosome and associated proteins [BR:oas03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114113187 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  114113187 NCBI-ProteinID:  XP_027820773 LinkDB All DBs Position 1:99947816..99951355 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgaggaaagggcggcaaaggcttaggcaagggtggcgccaagcgccaccgc aaagtcttgagagataacatccaaggcatcactaagccggccattcggcgccttgctcgg cgtgggggagtcaagcgcatttccggcctcatttacgaggagacccgaggcgtgttgaag gtgtttctggagaatgttattcgggacgcagtcacctacacggagcacgccaagcgcaag acggtcactgccatggacgtggtctacgcgctaaagcggcagggacgcaccctgtacggc ttcggaggttga

DBGET integrated database retrieval system