Ovis aries (sheep): 114116812 Help Entry 114116812         CDS       T03117                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism oas  Ovis aries (sheep) Pathway oas04014   Ras signaling pathway oas04015   Rap1 signaling pathway oas04022   cGMP-PKG signaling pathway oas04024   cAMP signaling pathway oas04062   Chemokine signaling pathway oas04071   Sphingolipid signaling pathway oas04072   Phospholipase D signaling pathway oas04081   Hormone signaling oas04144   Endocytosis oas04150   mTOR signaling pathway oas04270   Vascular smooth muscle contraction oas04310   Wnt signaling pathway oas04350   TGF-beta signaling pathway oas04360   Axon guidance oas04510   Focal adhesion oas04520   Adherens junction oas04530   Tight junction oas04611   Platelet activation oas04621   NOD-like receptor signaling pathway oas04625   C-type lectin receptor signaling pathway oas04660   T cell receptor signaling pathway oas04670   Leukocyte transendothelial migration oas04722   Neurotrophin signaling pathway oas04810   Regulation of actin cytoskeleton oas04921   Oxytocin signaling pathway oas04928   Parathyroid hormone synthesis, secretion and action oas04972   Pancreatic secretion oas05100   Bacterial invasion of epithelial cells oas05132   Salmonella infection oas05133   Pertussis oas05135   Yersinia infection oas05152   Tuberculosis oas05163   Human cytomegalovirus infection oas05200   Pathways in cancer oas05203   Viral carcinogenesis oas05205   Proteoglycans in cancer oas05206   MicroRNAs in cancer oas05210   Colorectal cancer oas05417   Lipid and atherosclerosis oas05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     114116812    04015 Rap1 signaling pathway     114116812    04310 Wnt signaling pathway     114116812    04350 TGF-beta signaling pathway     114116812    04072 Phospholipase D signaling pathway     114116812    04071 Sphingolipid signaling pathway     114116812    04024 cAMP signaling pathway     114116812    04022 cGMP-PKG signaling pathway     114116812    04150 mTOR signaling pathway     114116812   09133 Signaling molecules and interaction    04081 Hormone signaling     114116812  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114116812   09144 Cellular community - eukaryotes    04510 Focal adhesion     114116812    04520 Adherens junction     114116812    04530 Tight junction     114116812   09142 Cell motility    04810 Regulation of actin cytoskeleton     114116812  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     114116812    04621 NOD-like receptor signaling pathway     114116812    04625 C-type lectin receptor signaling pathway     114116812    04660 T cell receptor signaling pathway     114116812    04670 Leukocyte transendothelial migration     114116812    04062 Chemokine signaling pathway     114116812   09152 Endocrine system    04921 Oxytocin signaling pathway     114116812    04928 Parathyroid hormone synthesis, secretion and action     114116812   09153 Circulatory system    04270 Vascular smooth muscle contraction     114116812   09154 Digestive system    04972 Pancreatic secretion     114116812   09156 Nervous system    04722 Neurotrophin signaling pathway     114116812   09158 Development and regeneration    04360 Axon guidance     114116812  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114116812    05206 MicroRNAs in cancer     114116812    05205 Proteoglycans in cancer     114116812    05203 Viral carcinogenesis     114116812   09162 Cancer: specific types    05210 Colorectal cancer     114116812   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     114116812   09171 Infectious disease: bacterial    05132 Salmonella infection     114116812    05135 Yersinia infection     114116812    05133 Pertussis     114116812    05152 Tuberculosis     114116812    05100 Bacterial invasion of epithelial cells     114116812   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114116812    05418 Fluid shear stress and atherosclerosis     114116812  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     114116812   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     114116812    04031 GTP-binding proteins [BR:oas04031]     114116812 Membrane trafficking [BR:oas04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     114116812 Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114116812   Exosomal proteins of other body fluids (saliva and urine)    114116812   Exosomal proteins of colorectal cancer cells    114116812   Exosomal proteins of bladder cancer cells    114116812 GTP-binding proteins [BR:oas04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     114116812 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU VASP_tetra SRPRB Motif Other DBs NCBI-GeneID:  114116812 NCBI-ProteinID:  XP_042112402 LinkDB All DBs Position 11:60059265..60060657 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELASWDT DGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtccctacggtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggcttcgtgggacaca gatgggcaggaagattatgatcgcttgaggcctctctcctacccggataccgacgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccggaaaaatggact ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaacgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system