Ovis aries (sheep): 114117787 Help Entry 114117787         CDS       T03117                                  Name (RefSeq) C-C motif chemokine 17-like   KO K21083   C-C motif chemokine 17 Organism oas  Ovis aries (sheep) Pathway oas04060   Cytokine-cytokine receptor interaction oas04061   Viral protein interaction with cytokine and cytokine receptor oas04062   Chemokine signaling pathway oas04625   C-type lectin receptor signaling pathway oas04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114117787    04061 Viral protein interaction with cytokine and cytokine receptor     114117787  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114117787    04657 IL-17 signaling pathway     114117787    04062 Chemokine signaling pathway     114117787  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     114117787 Cytokines and neuropeptides [BR:oas04052]  Cytokines   Chemokines    114117787 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 NEDD4_Bsd2 Motif Other DBs NCBI-GeneID:  114117787 NCBI-ProteinID:  XP_027833350 LinkDB All DBs Position 14:25003391..25006273 Genome browser AA seq 102 aa AA seqDB search MAPLKTLLLVGLLLGALLQDAHAARAGSVGRECCLQFYKGSISQYELVDWYRTSGNCPNN AIVLVTRSGRTLCANPKDRKVKMAVGYLQKHMKSPNLAFQES NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggcccccctgaagacgctgctcctggtcggcctcctcctgggggctctcctgcaggac gcccacgcagctcgagcaggcagcgtgggccgggagtgctgcctacagttctacaaagga tccatttcccaatacgagctggtggattggtaccggacatcgggcaattgtcccaacaat gccattgtgctggtgactcgctctggcagaaccctttgtgcaaaccccaaggacagaaag gtgaagatggcagtggggtacttgcagaaacacatgaagtcacctaatctggccttccag gagtcttga

DBGET integrated database retrieval system