Ovis aries (sheep): 121820456 Help Entry 121820456         CDS       T03117                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism oas  Ovis aries (sheep) Pathway oas04014   Ras signaling pathway oas04015   Rap1 signaling pathway oas04020   Calcium signaling pathway oas04022   cGMP-PKG signaling pathway oas04024   cAMP signaling pathway oas04070   Phosphatidylinositol signaling system oas04114   Oocyte meiosis oas04218   Cellular senescence oas04261   Adrenergic signaling in cardiomyocytes oas04270   Vascular smooth muscle contraction oas04371   Apelin signaling pathway oas04625   C-type lectin receptor signaling pathway oas04713   Circadian entrainment oas04720   Long-term potentiation oas04722   Neurotrophin signaling pathway oas04728   Dopaminergic synapse oas04740   Olfactory transduction oas04744   Phototransduction oas04750   Inflammatory mediator regulation of TRP channels oas04910   Insulin signaling pathway oas04912   GnRH signaling pathway oas04915   Estrogen signaling pathway oas04916   Melanogenesis oas04921   Oxytocin signaling pathway oas04922   Glucagon signaling pathway oas04924   Renin secretion oas04925   Aldosterone synthesis and secretion oas04970   Salivary secretion oas04971   Gastric acid secretion oas05010   Alzheimer disease oas05012   Parkinson disease oas05022   Pathways of neurodegeneration - multiple diseases oas05031   Amphetamine addiction oas05034   Alcoholism oas05133   Pertussis oas05152   Tuberculosis oas05163   Human cytomegalovirus infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05170   Human immunodeficiency virus 1 infection oas05200   Pathways in cancer oas05214   Glioma oas05417   Lipid and atherosclerosis oas05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121820456    04015 Rap1 signaling pathway     121820456    04371 Apelin signaling pathway     121820456    04020 Calcium signaling pathway     121820456    04070 Phosphatidylinositol signaling system     121820456    04024 cAMP signaling pathway     121820456    04022 cGMP-PKG signaling pathway     121820456  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     121820456    04218 Cellular senescence     121820456  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121820456   09152 Endocrine system    04910 Insulin signaling pathway     121820456    04922 Glucagon signaling pathway     121820456    04912 GnRH signaling pathway     121820456    04915 Estrogen signaling pathway     121820456    04921 Oxytocin signaling pathway     121820456    04916 Melanogenesis     121820456    04924 Renin secretion     121820456    04925 Aldosterone synthesis and secretion     121820456   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     121820456    04270 Vascular smooth muscle contraction     121820456   09154 Digestive system    04970 Salivary secretion     121820456    04971 Gastric acid secretion     121820456   09156 Nervous system    04728 Dopaminergic synapse     121820456    04720 Long-term potentiation     121820456    04722 Neurotrophin signaling pathway     121820456   09157 Sensory system    04744 Phototransduction     121820456    04740 Olfactory transduction     121820456    04750 Inflammatory mediator regulation of TRP channels     121820456   09159 Environmental adaptation    04713 Circadian entrainment     121820456  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121820456   09162 Cancer: specific types    05214 Glioma     121820456   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121820456    05163 Human cytomegalovirus infection     121820456    05167 Kaposi sarcoma-associated herpesvirus infection     121820456   09171 Infectious disease: bacterial    05133 Pertussis     121820456    05152 Tuberculosis     121820456   09164 Neurodegenerative disease    05010 Alzheimer disease     121820456    05012 Parkinson disease     121820456    05022 Pathways of neurodegeneration - multiple diseases     121820456   09165 Substance dependence    05031 Amphetamine addiction     121820456    05034 Alcoholism     121820456   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121820456    05418 Fluid shear stress and atherosclerosis     121820456  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oas01009]     121820456   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     121820456    03036 Chromosome and associated proteins [BR:oas03036]     121820456   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     121820456 Protein phosphatases and associated proteins [BR:oas01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121820456 Membrane trafficking [BR:oas04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     121820456 Chromosome and associated proteins [BR:oas03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      121820456 Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121820456 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C SPARC_Ca_bdg EF-hand_11 EF_EFCAB10_C EF_SSP120 Dockerin_1 EFhand_Ca_insen SAPC2_N EF-hand_EFHB_C UPF0154 TerB DUF1103 RNA_pol_Rpb4 FCaBP_EF-hand BamM_C Caleosin SPEF2_C EF-hand_STIM1 DUF5580_M PA_Ig-like DUF8640 DUF2267 Motif Other DBs NCBI-GeneID:  121820456 NCBI-ProteinID:  XP_042110915 LinkDB All DBs Position 10:68448664..68449810 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLEEKLTDE EVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaccagctgactgaagagcagattgcagaattcaaagaagctttttcactattt gacaaggatggtgatggaactataacaacaaaggaattgggaactgtaatgcggtctctt gggcagaatcccacagaagcagagttacaggacatgattaatgaagtagatgctgatggt aatggcacaattgacttcccggaatttctgacaatgatggcaagaaaaatgaaagataca gacagtgaagaagaaattagagaagcattccgtgtgtttgataaggatggtaatggctat attagtgcagcagagctccgccatgtgatgacaaaccttgaagagaagttaacagatgaa gaggttgatgaaatgatcagggaagcagatattgatggtgatggtcaagtaaactatgaa gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system