Ovis aries (sheep): 443061 Help Entry 443061            CDS       T03117                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism oas  Ovis aries (sheep) Pathway oas01521   EGFR tyrosine kinase inhibitor resistance oas01524   Platinum drug resistance oas04014   Ras signaling pathway oas04064   NF-kappa B signaling pathway oas04115   p53 signaling pathway oas04137   Mitophagy - animal oas04140   Autophagy - animal oas04151   PI3K-Akt signaling pathway oas04210   Apoptosis oas04215   Apoptosis - multiple species oas04621   NOD-like receptor signaling pathway oas04630   JAK-STAT signaling pathway oas05012   Parkinson disease oas05014   Amyotrophic lateral sclerosis oas05022   Pathways of neurodegeneration - multiple diseases oas05145   Toxoplasmosis oas05162   Measles oas05166   Human T-cell leukemia virus 1 infection oas05168   Herpes simplex virus 1 infection oas05170   Human immunodeficiency virus 1 infection oas05200   Pathways in cancer oas05202   Transcriptional misregulation in cancer oas05212   Pancreatic cancer oas05220   Chronic myeloid leukemia oas05222   Small cell lung cancer oas05225   Hepatocellular carcinoma oas05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     443061 (BCL2L1)    04630 JAK-STAT signaling pathway     443061 (BCL2L1)    04064 NF-kappa B signaling pathway     443061 (BCL2L1)    04151 PI3K-Akt signaling pathway     443061 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     443061 (BCL2L1)    04137 Mitophagy - animal     443061 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     443061 (BCL2L1)    04215 Apoptosis - multiple species     443061 (BCL2L1)    04115 p53 signaling pathway     443061 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     443061 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     443061 (BCL2L1)    05202 Transcriptional misregulation in cancer     443061 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     443061 (BCL2L1)    05225 Hepatocellular carcinoma     443061 (BCL2L1)    05220 Chronic myeloid leukemia     443061 (BCL2L1)    05222 Small cell lung cancer     443061 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     443061 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     443061 (BCL2L1)    05162 Measles     443061 (BCL2L1)    05168 Herpes simplex virus 1 infection     443061 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     443061 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     443061 (BCL2L1)    05014 Amyotrophic lateral sclerosis     443061 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     443061 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     443061 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     443061 (BCL2L1)    01524 Platinum drug resistance     443061 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oas01009]     443061 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oas03036]     443061 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:oas02000]     443061 (BCL2L1) Protein phosphatases and associated proteins [BR:oas01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      443061 (BCL2L1) Chromosome and associated proteins [BR:oas03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     443061 (BCL2L1) Transporters [BR:oas02000]  Other transporters   Pores ion channels [TC:1]    443061 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  443061 NCBI-ProteinID:  NP_001009226 UniProt:  Q9MZS7 A0A6P3TJ46 LinkDB All DBs Position 13:complement(60888881..60941710) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLA DSPAVNGATGHSRSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcttacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg acagaatcagatatggaaacccccagtgccatcaatggcaacccatcttggcacctggcg gatagccctgcggtgaatggagccaccggccacagcagaagcttggatgcccgggaagtg atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg taccgacgggcattcagcgacctgacgtcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggctacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacgtttgtggaactctacgggaacaacgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system