Ovis aries (sheep): 443219 Help Entry 443219            CDS       T03117                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism oas  Ovis aries (sheep) Pathway oas01522   Endocrine resistance oas04010   MAPK signaling pathway oas04012   ErbB signaling pathway oas04024   cAMP signaling pathway oas04137   Mitophagy - animal oas04210   Apoptosis oas04310   Wnt signaling pathway oas04380   Osteoclast differentiation oas04510   Focal adhesion oas04530   Tight junction oas04620   Toll-like receptor signaling pathway oas04621   NOD-like receptor signaling pathway oas04625   C-type lectin receptor signaling pathway oas04657   IL-17 signaling pathway oas04658   Th1 and Th2 cell differentiation oas04659   Th17 cell differentiation oas04660   T cell receptor signaling pathway oas04662   B cell receptor signaling pathway oas04668   TNF signaling pathway oas04722   Neurotrophin signaling pathway oas04912   GnRH signaling pathway oas04915   Estrogen signaling pathway oas04921   Oxytocin signaling pathway oas04926   Relaxin signaling pathway oas04932   Non-alcoholic fatty liver disease oas04933   AGE-RAGE signaling pathway in diabetic complications oas05030   Cocaine addiction oas05031   Amphetamine addiction oas05132   Salmonella infection oas05133   Pertussis oas05135   Yersinia infection oas05140   Leishmaniasis oas05142   Chagas disease oas05161   Hepatitis B oas05162   Measles oas05166   Human T-cell leukemia virus 1 infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05169   Epstein-Barr virus infection oas05170   Human immunodeficiency virus 1 infection oas05171   Coronavirus disease - COVID-19 oas05200   Pathways in cancer oas05203   Viral carcinogenesis oas05207   Chemical carcinogenesis - receptor activation oas05208   Chemical carcinogenesis - reactive oxygen species oas05210   Colorectal cancer oas05211   Renal cell carcinoma oas05224   Breast cancer oas05231   Choline metabolism in cancer oas05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oas05321   Inflammatory bowel disease oas05323   Rheumatoid arthritis oas05417   Lipid and atherosclerosis oas05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     443219 (JUN)    04012 ErbB signaling pathway     443219 (JUN)    04310 Wnt signaling pathway     443219 (JUN)    04668 TNF signaling pathway     443219 (JUN)    04024 cAMP signaling pathway     443219 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     443219 (JUN)   09143 Cell growth and death    04210 Apoptosis     443219 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     443219 (JUN)    04530 Tight junction     443219 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     443219 (JUN)    04621 NOD-like receptor signaling pathway     443219 (JUN)    04625 C-type lectin receptor signaling pathway     443219 (JUN)    04660 T cell receptor signaling pathway     443219 (JUN)    04658 Th1 and Th2 cell differentiation     443219 (JUN)    04659 Th17 cell differentiation     443219 (JUN)    04657 IL-17 signaling pathway     443219 (JUN)    04662 B cell receptor signaling pathway     443219 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     443219 (JUN)    04915 Estrogen signaling pathway     443219 (JUN)    04921 Oxytocin signaling pathway     443219 (JUN)    04926 Relaxin signaling pathway     443219 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     443219 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     443219 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     443219 (JUN)    05207 Chemical carcinogenesis - receptor activation     443219 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     443219 (JUN)    05203 Viral carcinogenesis     443219 (JUN)    05231 Choline metabolism in cancer     443219 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     443219 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     443219 (JUN)    05211 Renal cell carcinoma     443219 (JUN)    05224 Breast cancer     443219 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     443219 (JUN)    05170 Human immunodeficiency virus 1 infection     443219 (JUN)    05161 Hepatitis B     443219 (JUN)    05171 Coronavirus disease - COVID-19     443219 (JUN)    05162 Measles     443219 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     443219 (JUN)    05169 Epstein-Barr virus infection     443219 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     443219 (JUN)    05135 Yersinia infection     443219 (JUN)    05133 Pertussis     443219 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     443219 (JUN)    05142 Chagas disease     443219 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     443219 (JUN)    05321 Inflammatory bowel disease     443219 (JUN)   09165 Substance dependence    05030 Cocaine addiction     443219 (JUN)    05031 Amphetamine addiction     443219 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     443219 (JUN)    05418 Fluid shear stress and atherosclerosis     443219 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     443219 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     443219 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     443219 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oas03000]     443219 (JUN) Transcription factors [BR:oas03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     443219 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 ZapB PspA_IM30 Fib_alpha TFIIA ATG16 DUF3450 FlaC_arch Motif Other DBs NCBI-GeneID:  443219 NCBI-ProteinID:  XP_004002069 UniProt:  W5PJV1 LinkDB All DBs Position 1:complement(33493970..33496663) Genome browser AA seq 335 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMP GETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAS TANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tctgagagcggcgcctacggctacagtaaccccaagattctgaagcagagcatgaccctg aatctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactccgacctc ctcacctcgcccgacgttgggctgctcaagctggcgtcgcccgagctggagcgcctgatc atacagtccagcaacgggcatatcaccaccacgccgacccccacccagttcctgtgcccc aagaacgtgacggacgagcaggagggattcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcctggtggccccggcggtggcctcggtggcgggcggcagcggcagcggcggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggctggcctggcctttcccgcgcag ccccagcagcagcagcagcaaccaccgcagccgccgcaccacctgccccagcagataccc gtgcagcacccgcggctgcaggccctgaaggaagagccgcagacggtgcccgagatgccc ggggaaacgccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggag aggaagcgcatgaggaaccgcatcgctgcttccaagtgccggaaaaggaagctggagagg atcgcgcggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtcc accgccaatatgctcagggaacaggtggcccagcttaaacaaaaagtcatgaaccacgtt aacagcgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system