Ovis aries (sheep): 443350 Help Entry 443350            CDS       T03117                                  Symbol IL5 Name (RefSeq) interleukin-5 precursor   KO K05428   interleukin 5 Organism oas  Ovis aries (sheep) Pathway oas04060   Cytokine-cytokine receptor interaction oas04630   JAK-STAT signaling pathway oas04640   Hematopoietic cell lineage oas04657   IL-17 signaling pathway oas04658   Th1 and Th2 cell differentiation oas04660   T cell receptor signaling pathway oas04664   Fc epsilon RI signaling pathway oas04672   Intestinal immune network for IgA production oas05200   Pathways in cancer oas05310   Asthma oas05320   Autoimmune thyroid disease oas05321   Inflammatory bowel disease oas05330   Allograft rejection Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     443350 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     443350 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     443350 (IL5)    04660 T cell receptor signaling pathway     443350 (IL5)    04658 Th1 and Th2 cell differentiation     443350 (IL5)    04657 IL-17 signaling pathway     443350 (IL5)    04664 Fc epsilon RI signaling pathway     443350 (IL5)    04672 Intestinal immune network for IgA production     443350 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     443350 (IL5)   09163 Immune disease    05310 Asthma     443350 (IL5)    05320 Autoimmune thyroid disease     443350 (IL5)    05321 Inflammatory bowel disease     443350 (IL5)    05330 Allograft rejection     443350 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     443350 (IL5)    00536 Glycosaminoglycan binding proteins [BR:oas00536]     443350 (IL5) Cytokines and neuropeptides [BR:oas04052]  Cytokines   Interleukins    443350 (IL5) Glycosaminoglycan binding proteins [BR:oas00536]  Heparan sulfate / Heparin   Cytokines    443350 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  443350 NCBI-ProteinID:  NP_001009783 UniProt:  Q28586 LinkDB All DBs Position 5:19679265..19681636 Genome browser AA seq 132 aa AA seqDB search MHLRLTLVALGAAYVCANAVESTMNRLVAETLTLLSTHQTLLIGDGNLMIPTPQHTNHQL CIEEVFQGIDTLKNQTAQGDAVKKIFRNLSLIKEYIDLQKRKCGGERWRVKQFLDYLQVF LGVINTEWTMES NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgcatctgcgtttgaccttggtagctcttggagctgcctatgtttgtgccaatgctgta gaaagtaccatgaatagactggtggcagagaccttgacactgctctccacgcatcaaact ctgctgataggtgatgggaacttgatgattcctactcctcagcatacaaatcaccaacta tgcattgaagaagtctttcagggaatagacacattgaagaatcaaactgcacaaggggat gctgtgaaaaaaatattccgaaacttgtctttaataaaagaatacatagacctccaaaaa aggaagtgtggaggagaaagatggagagtgaaacaattcctcgactacctgcaagttttc cttggtgtgataaacacagagtggacgatggaaagctga

DBGET integrated database retrieval system