Ovis aries (sheep): 443390 Help Entry 443390            CDS       T03117                                  Symbol OXT Name (RefSeq) oxytocin-neurophysin 1 precursor   KO K05243   oxytocin-neurophysin 1 Organism oas  Ovis aries (sheep) Pathway oas04024   cAMP signaling pathway oas04080   Neuroactive ligand-receptor interaction oas04081   Hormone signaling oas04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     443390 (OXT)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     443390 (OXT)    04081 Hormone signaling     443390 (OXT)  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     443390 (OXT)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     443390 (OXT) Cytokines and neuropeptides [BR:oas04052]  Neuropeptides   GPCR binding    443390 (OXT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_5 Hormone_4 Motif Other DBs NCBI-GeneID:  443390 NCBI-ProteinID:  NP_001009801 UniProt:  P13389 LinkDB All DBs Position 13:complement(51828205..51829108) Genome browser AA seq 125 aa AA seqDB search MAGSSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDVRTCLPCGPGAKGRCFGPSICCG DELGCFVGTAEALRCREENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGSHADPACDPEA AFSQH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcaggttccagcctcgcctgctgcctgctcggcctcctggcgttgacctccgcctgc tacattcagaactgccccctgggcggcaagcgtgcggtgctggacctcgacgtgcgcacg tgtctcccctgcggccccggggcgaaaggccgctgcttcgggcccagcatctgctgcggg gacgagctgggctgcttcgtgggcacggccgaggcgctgcgctgccgagaggagaactac ctgccgtcgccctgccagtccggccagaagccctgcgggagcgggggccgctgcgccgcc gccgggatctgctgcagcccggacggctcgcacgcggatcctgcctgcgaccccgaggcc gccttctcccagcactga

DBGET integrated database retrieval system