Ovis aries (sheep): 443404 Help Entry 443404            CDS       T03117                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha precursor   KO K04383   interleukin 1 alpha Organism oas  Ovis aries (sheep) Pathway oas04010   MAPK signaling pathway oas04060   Cytokine-cytokine receptor interaction oas04217   Necroptosis oas04218   Cellular senescence oas04380   Osteoclast differentiation oas04640   Hematopoietic cell lineage oas04932   Non-alcoholic fatty liver disease oas04933   AGE-RAGE signaling pathway in diabetic complications oas04940   Type I diabetes mellitus oas05010   Alzheimer disease oas05020   Prion disease oas05022   Pathways of neurodegeneration - multiple diseases oas05133   Pertussis oas05140   Leishmaniasis oas05152   Tuberculosis oas05162   Measles oas05164   Influenza A oas05321   Inflammatory bowel disease oas05323   Rheumatoid arthritis oas05332   Graft-versus-host disease oas05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     443404 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     443404 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     443404 (IL1A)    04218 Cellular senescence     443404 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     443404 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     443404 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     443404 (IL1A)    05162 Measles     443404 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     443404 (IL1A)    05152 Tuberculosis     443404 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     443404 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     443404 (IL1A)    05321 Inflammatory bowel disease     443404 (IL1A)    05332 Graft-versus-host disease     443404 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     443404 (IL1A)    05020 Prion disease     443404 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     443404 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     443404 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     443404 (IL1A)    04932 Non-alcoholic fatty liver disease     443404 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     443404 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     443404 (IL1A) Cytokines and neuropeptides [BR:oas04052]  Cytokines   Interleukins    443404 (IL1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1_propep IL1 DUF6108 DUF4937 Motif Other DBs NCBI-GeneID:  443404 NCBI-ProteinID:  NP_001009808 UniProt:  Q28579 LinkDB All DBs Position 3:60203022..60214021 Genome browser AA seq 268 aa AA seqDB search MAKVPDLFEDLKNCYSENEDYSSEIDHLSLNQKSFYDASYEPLREDHMNKFMSLDTSETS KTSRLSFKENVVMVTANGKILKKRRLSLNQFITDDDLEAIANDTEEEIIKPRSAHYSFQS NVKYNFMRVIHQECILNDALNQSIIRDMSGPYMTAATLNNLEEAVKFDMVAYVSEEDSQL PVTLRISKTQLFVSAQNEDEPVLHKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPK LFIATKQEKLVHMASGPPSITDFLILEK NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggccaaagtccctgacctctttgaagacctgaagaactgttacagtgaaaatgaagac tacagttctgaaattgaccacctctctctgaatcagaagtccttctatgatgcaagctat gagccacttcgtgaggaccacatgaataagtttatgtccctggatacctcggaaacctcc aagacatccaggcttagcttcaaggagaatgtggtgatggtgacagccaatggcaagatt ctgaagaagagacggttgagtttaaatcagttcatcaccgatgatgacctggaagccatt gccaatgataccgaagaagaaatcatcaagcccagatcagcacattacagcttccagagt aacgtgaaatacaactttatgagagtcatccaccaggaatgcatcctgaacgacgccctc aatcaaagtataattcgagatatgtcaggtccatacatgacggctgctacattaaataat ctggaggaggcagtgaaatttgacatggttgcttatgtatcagaagaggattctcagctt cctgtgactctaagaatctcaaaaactcaactgtttgtgagtgctcaaaatgaagacgaa cccgtcttgcataaggagatgcctgagacacccaaaatcatcaaagatgagaccaatctc ctcttcttctgggaaaagcatgggtctatggactacttcaaatcagttgcccatccaaag ttgttcattgccacaaagcaagaaaaactggtgcacatggcaagcgggccgccctcgatc actgactttctgatattggaaaaatag

DBGET integrated database retrieval system