Ovis aries (sheep): 445468 Help Entry 445468            CDS       T03117                                  Symbol CAV1 Name (RefSeq) caveolin-1   KO K06278   caveolin 1 Organism oas  Ovis aries (sheep) Pathway oas04144   Endocytosis oas04510   Focal adhesion oas05020   Prion disease oas05100   Bacterial invasion of epithelial cells oas05205   Proteoglycans in cancer oas05416   Viral myocarditis oas05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     445468 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     445468 (CAV1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     445468 (CAV1)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     445468 (CAV1)   09164 Neurodegenerative disease    05020 Prion disease     445468 (CAV1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     445468 (CAV1)    05416 Viral myocarditis     445468 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     445468 (CAV1) Membrane trafficking [BR:oas04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     445468 (CAV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  445468 NCBI-ProteinID:  NP_001009477 UniProt:  Q6B3Y2 LinkDB All DBs Position 4:complement(53341135..53376048) Genome browser AA seq 178 aa AA seqDB search MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMNEKQVYDAHTKEIDLVNRDPKHLN DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRINTQKEI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgtcggggggcaaatacgtagactcagagggacatctctacactgttcccatccgggaa cagggcaacatctacaagcccaacaacaaggctatggcagaggaaatgaacgagaagcaa gtgtacgacgcgcacaccaaggagatagatctggtcaaccgcgaccccaagcatctcaac gacgacgtggtcaagattgattttgaagatgtgattgcagaaccagaaggaacacacagt ttcgatggcatctggaaggccagcttcaccaccttcactgtgacaaagtactggttttac cgtttgctgtctgccctctttggcatcccaatggcactcatctggggcatttactttgcc attctctctttcctgcacatctgggcagttgtaccatgcattaagagtttcctgattgag attcagtgcatcagccgtgtctattccatctacgtccacaccttctgtgacccgctgttt gaggctattggcaaaatattcagcaatatccgcatcaacacgcagaaagaaatataa

DBGET integrated database retrieval system