Ovis aries (sheep): 492823 Help Entry 492823            CDS       T03117                                  Symbol IFN1 Name (RefSeq) interferon alpha-1   KO K05414   interferon alpha Organism oas  Ovis aries (sheep) Pathway oas04060   Cytokine-cytokine receptor interaction oas04151   PI3K-Akt signaling pathway oas04217   Necroptosis oas04620   Toll-like receptor signaling pathway oas04621   NOD-like receptor signaling pathway oas04622   RIG-I-like receptor signaling pathway oas04623   Cytosolic DNA-sensing pathway oas04630   JAK-STAT signaling pathway oas04650   Natural killer cell mediated cytotoxicity oas04936   Alcoholic liver disease oas05152   Tuberculosis oas05160   Hepatitis C oas05161   Hepatitis B oas05162   Measles oas05163   Human cytomegalovirus infection oas05164   Influenza A oas05165   Human papillomavirus infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05168   Herpes simplex virus 1 infection oas05169   Epstein-Barr virus infection oas05170   Human immunodeficiency virus 1 infection oas05171   Coronavirus disease - COVID-19 oas05200   Pathways in cancer oas05320   Autoimmune thyroid disease oas05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     492823 (IFN1)    04151 PI3K-Akt signaling pathway     492823 (IFN1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     492823 (IFN1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     492823 (IFN1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     492823 (IFN1)    04621 NOD-like receptor signaling pathway     492823 (IFN1)    04622 RIG-I-like receptor signaling pathway     492823 (IFN1)    04623 Cytosolic DNA-sensing pathway     492823 (IFN1)    04650 Natural killer cell mediated cytotoxicity     492823 (IFN1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     492823 (IFN1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     492823 (IFN1)    05161 Hepatitis B     492823 (IFN1)    05160 Hepatitis C     492823 (IFN1)    05171 Coronavirus disease - COVID-19     492823 (IFN1)    05164 Influenza A     492823 (IFN1)    05162 Measles     492823 (IFN1)    05168 Herpes simplex virus 1 infection     492823 (IFN1)    05163 Human cytomegalovirus infection     492823 (IFN1)    05167 Kaposi sarcoma-associated herpesvirus infection     492823 (IFN1)    05169 Epstein-Barr virus infection     492823 (IFN1)    05165 Human papillomavirus infection     492823 (IFN1)   09171 Infectious disease: bacterial    05152 Tuberculosis     492823 (IFN1)   09163 Immune disease    05320 Autoimmune thyroid disease     492823 (IFN1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     492823 (IFN1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     492823 (IFN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     492823 (IFN1) Cytokines and neuropeptides [BR:oas04052]  Cytokines   Interferons    492823 (IFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  492823 NCBI-ProteinID:  XP_004005368 LinkDB All DBs Position 2:90170026..90170595 Genome browser AA seq 189 aa AA seqDB search MAAAWSLLLALLLLSCNAICSWGCHLPHTHSLANRRVLTLLQQLRRVSPSSCLQDRKDFA FPQKALGGSQLQKVQAISVLHEVTQHTFQLFSTEGSAAAWDRSLLDKLRTTLDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKHFHRVTLYLQEKGHSPCAWEVVRAEVLRAFSSSTN LQERFRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccgcagcctggtccttgctcctggccctgctgctgctcagctgcaacgccatctgc tcttggggctgccacctgcctcacacccacagcctggccaacaggagggtcctgacgctc ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaaagacttcgca ttcccccagaaggcgctgggcggcagccagttgcagaaggttcaggccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcgtgg gaccggagcctcctggacaagctccgcaccacactggatcagcagctcactgacctgcaa gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaacacttccacagagtcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcttgagagccttctcttcctcaacaaac ttgcaggagagattcaggagcaaggactga

DBGET integrated database retrieval system