Ovis aries (sheep): 780520 Help Entry 780520            CDS       T03117                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism oas  Ovis aries (sheep) Pathway oas04024   cAMP signaling pathway oas04062   Chemokine signaling pathway oas04064   NF-kappa B signaling pathway oas04210   Apoptosis oas04380   Osteoclast differentiation oas04620   Toll-like receptor signaling pathway oas04621   NOD-like receptor signaling pathway oas04622   RIG-I-like receptor signaling pathway oas04623   Cytosolic DNA-sensing pathway oas04625   C-type lectin receptor signaling pathway oas04657   IL-17 signaling pathway oas04658   Th1 and Th2 cell differentiation oas04659   Th17 cell differentiation oas04660   T cell receptor signaling pathway oas04662   B cell receptor signaling pathway oas04668   TNF signaling pathway oas04722   Neurotrophin signaling pathway oas04920   Adipocytokine signaling pathway oas04926   Relaxin signaling pathway oas04931   Insulin resistance oas04936   Alcoholic liver disease oas05132   Salmonella infection oas05134   Legionellosis oas05135   Yersinia infection oas05140   Leishmaniasis oas05142   Chagas disease oas05145   Toxoplasmosis oas05160   Hepatitis C oas05161   Hepatitis B oas05162   Measles oas05163   Human cytomegalovirus infection oas05164   Influenza A oas05166   Human T-cell leukemia virus 1 infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05168   Herpes simplex virus 1 infection oas05169   Epstein-Barr virus infection oas05170   Human immunodeficiency virus 1 infection oas05171   Coronavirus disease - COVID-19 oas05200   Pathways in cancer oas05203   Viral carcinogenesis oas05208   Chemical carcinogenesis - reactive oxygen species oas05215   Prostate cancer oas05220   Chronic myeloid leukemia oas05222   Small cell lung cancer oas05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oas05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     780520 (NFKBIA)    04668 TNF signaling pathway     780520 (NFKBIA)    04024 cAMP signaling pathway     780520 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     780520 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     780520 (NFKBIA)    04621 NOD-like receptor signaling pathway     780520 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     780520 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     780520 (NFKBIA)    04625 C-type lectin receptor signaling pathway     780520 (NFKBIA)    04660 T cell receptor signaling pathway     780520 (NFKBIA)    04658 Th1 and Th2 cell differentiation     780520 (NFKBIA)    04659 Th17 cell differentiation     780520 (NFKBIA)    04657 IL-17 signaling pathway     780520 (NFKBIA)    04662 B cell receptor signaling pathway     780520 (NFKBIA)    04062 Chemokine signaling pathway     780520 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     780520 (NFKBIA)    04926 Relaxin signaling pathway     780520 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     780520 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     780520 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     780520 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     780520 (NFKBIA)    05203 Viral carcinogenesis     780520 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     780520 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     780520 (NFKBIA)    05215 Prostate cancer     780520 (NFKBIA)    05222 Small cell lung cancer     780520 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     780520 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     780520 (NFKBIA)    05161 Hepatitis B     780520 (NFKBIA)    05160 Hepatitis C     780520 (NFKBIA)    05171 Coronavirus disease - COVID-19     780520 (NFKBIA)    05164 Influenza A     780520 (NFKBIA)    05162 Measles     780520 (NFKBIA)    05168 Herpes simplex virus 1 infection     780520 (NFKBIA)    05163 Human cytomegalovirus infection     780520 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     780520 (NFKBIA)    05169 Epstein-Barr virus infection     780520 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     780520 (NFKBIA)    05135 Yersinia infection     780520 (NFKBIA)    05134 Legionellosis     780520 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     780520 (NFKBIA)    05140 Leishmaniasis     780520 (NFKBIA)    05142 Chagas disease     780520 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     780520 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     780520 (NFKBIA)    04931 Insulin resistance     780520 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oas03000]     780520 (NFKBIA)    04131 Membrane trafficking [BR:oas04131]     780520 (NFKBIA) Transcription factors [BR:oas03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     780520 (NFKBIA) Membrane trafficking [BR:oas04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     780520 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  780520 NCBI-ProteinID:  NP_001159656 UniProt:  C8BKC0 A0A6P9FQP9 LinkDB All DBs Position 18:complement(43394395..43397347) Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQQLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc aagaaggagaggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggccctcaccatggaagtggtccgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc actaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagccccggggaacccagcagctccactccattctgcaggccaccaac tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctgttgaagtgtggg gctgatgtcaacagagtcacctaccagggctactccccgtaccagctcacgtggggccgc cccagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagacactg ccagagagcgaggatgaggaaagctatgacaccgaatcagagttcacagaagatgagctt ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system