Octadecabacter antarcticus: OAN307_c06480 Help Entry OAN307_c06480     CDS       T02538                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism oat  Octadecabacter antarcticus Pathway oat00190   Oxidative phosphorylation oat01100   Metabolic pathways Module oat_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:oat00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     OAN307_c06480 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:oat00194]     OAN307_c06480 (atpE) Photosynthesis proteins [BR:oat00194]  Photosystem and electron transport system   F-type ATPase [OT]    OAN307_c06480 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AGI66375 UniProt:  M9R9E8 LinkDB All DBs Position 616979..617203 Genome browser AA seq 74 aa AA seqDB search MEGELAHIGAGLAAIGSGAAAIGVGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALG IFSFLVALLLMFAV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggaaggcgaactcgcacacatcggcgctggcttggctgcaattggttccggcgctgcc gcaatcggtgttggtcacgtggctggcaacttcctcgcaggggcactgcgtaacccatcg gctgctgccggtcagactgctacgctgtttatcggcatcgcattcgcagaagcactggga atcttttcgttcctcgttgcattgctgctgatgttcgcggtctaa

DBGET integrated database retrieval system