Oreochromis aureus (blue tilapia): 116312086 Help Entry 116312086         CDS       T07295                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism oau  Oreochromis aureus (blue tilapia) Pathway oau04010   MAPK signaling pathway oau04144   Endocytosis oau04370   VEGF signaling pathway oau04510   Focal adhesion oau04517   IgSF CAM signaling oau04518   Integrin signaling oau04520   Adherens junction oau04530   Tight junction oau04810   Regulation of actin cytoskeleton oau04912   GnRH signaling pathway oau05100   Bacterial invasion of epithelial cells oau05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oau00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116312086    04370 VEGF signaling pathway     116312086   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     116312086    04518 Integrin signaling     116312086  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116312086   09144 Cellular community - eukaryotes    04510 Focal adhesion     116312086    04520 Adherens junction     116312086    04530 Tight junction     116312086   09142 Cell motility    04810 Regulation of actin cytoskeleton     116312086  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     116312086  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116312086    05100 Bacterial invasion of epithelial cells     116312086  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oau04131]     116312086    03036 Chromosome and associated proteins [BR:oau03036]     116312086   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oau04147]     116312086    04031 GTP-binding proteins [BR:oau04031]     116312086 Membrane trafficking [BR:oau04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     116312086  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     116312086   Macropinocytosis    Ras GTPases     116312086 Chromosome and associated proteins [BR:oau03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     116312086 Exosome [BR:oau04147]  Exosomal proteins   Exosomal proteins of microglial cells    116312086   Exosomal proteins of breast milk    116312086 GTP-binding proteins [BR:oau04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     116312086 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RRM_PARP14_2 MukB DAP3 Motif Other DBs NCBI-GeneID:  116312086 NCBI-ProteinID:  XP_031585306 UniProt:  A0AAZ1XL29 LinkDB All DBs Position LG22 Genome browser AA seq 202 aa AA seqDB search MPRGGGGMTSQSDKEIKCVVVGDGAVGKTCMLIAYVTKAYPSEFIPTVFDNYSAKVTNGE EYNLVLWDTAGQEDYDRLRPLSYPETNVFLVCFSVVSPKSFQDVTEKWLPEIAHYCPGTP FLLVGTMVDLRDDSYTLEMLAKENEQVVTFKDGQELAHRLKAVKYMECSALTQIGVQDVF EEAVLAALGKSSSKPKKCCTQL NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgcccagaggtggtgggggcatgacatcacaaagtgataaggaaataaagtgtgtggtg gtgggtgacggtgcagtgggaaagacctgcatgctcatcgcatacgtaaccaaagcgtat ccctctgagttcatccccacagtgtttgataactactctgctaaagtgacgaatggtgaa gagtataatctggtactctgggacactgcaggtcaggaggactatgaccgattgcgaccc ctcagctacccagagaccaacgttttcctcgtctgtttctccgtcgtttcacccaaatct tttcaagatgtcacagaaaagtggttgccagagattgcacactactgtccggggacgccc ttcctgctggtcgggactatggtggatctgagagatgacagctacaccctggagatgctg gccaaggaaaacgagcaagttgtgaccttcaaggacggacaggaactggctcataggctg aaagctgtcaaatacatggagtgctcagctcttacacagataggagtgcaggatgtgttt gaagaggccgtccttgctgctctggggaagtcaagttccaaacccaagaagtgctgcact caactatag

DBGET integrated database retrieval system