Oreochromis aureus (blue tilapia): 116314887 Help Entry 116314887         CDS       T07295                                  Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism oau  Oreochromis aureus (blue tilapia) Pathway oau04115   p53 signaling pathway oau04137   Mitophagy - animal oau04140   Autophagy - animal oau04210   Apoptosis oau04621   NOD-like receptor signaling pathway oau05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:oau00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116314887    04137 Mitophagy - animal     116314887   09143 Cell growth and death    04210 Apoptosis     116314887    04115 p53 signaling pathway     116314887  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     116314887  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     116314887  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oau01009]     116314887   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oau03036]     116314887   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:oau02000]     116314887 Protein phosphatases and associated proteins [BR:oau01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      116314887 Chromosome and associated proteins [BR:oau03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     116314887 Transporters [BR:oau02000]  Other transporters   Pores ion channels [TC:1]    116314887 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 KxYKxGKxW_sig Motif Other DBs NCBI-GeneID:  116314887 NCBI-ProteinID:  XP_031588888 Ensembl:  ENSOABG00000000104 LinkDB All DBs Position LG5 Genome browser AA seq 197 aa AA seqDB search MQCSNRELVEFFISYKLSQKNHPTSLLRPTNGGQRTERDLAQSLPAYNGIEALKSALLDS GEQFGFLFTQSFRDVASHLSITPDTAQQCFESVMEELFRDGINWGRIIGLFVFGSAMCLD CIDSNMSELVPNIADWMTAYLDDHISLWIQRNGGWDRFTEIFGKGMSTRSSGESLKRWLF VGVALVTGLLVGMLMTD NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgcagtgcagtaaccgagagctggtggagttctttataagctataaactgtctcagaag aatcacccaacttcccttctgaggccaaccaatgggggccaaaggactgagagagacctg gcccaatctctgcctgcatacaatggcatagaggctttaaaatcagctcttctagactca ggggagcagtttggttttcttttcacacagtcttttagggacgttgcttcgcacctcagc atcacgccggacacagcccagcaatgcttcgagagcgtgatggaggagttgttcagggat ggaatcaactgggggcgtataattggtctgtttgtctttggttctgcaatgtgtctggac tgtattgacagcaatatgagtgagctggtacccaacattgcagactggatgactgcgtat ctagatgatcacattagtctgtggatccaacgaaatggaggatgggaccgctttacagag atatttgggaaagggatgtctacaaggagctctggggagtctctgaagagatggctattt gttggagtggccttagtaacagggctgctggttggcatgctcatgacagattaa

DBGET integrated database retrieval system