Oreochromis aureus (blue tilapia): 116315716 Help Entry 116315716         CDS       T07295                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism oau  Oreochromis aureus (blue tilapia) Pathway oau04382   Cornified envelope formation oau05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oau00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     116315716 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116315716 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oau04147]     116315716 (s100a10b) Exosome [BR:oau04147]  Exosomal proteins   Exosomal proteins of microglial cells    116315716 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 DEK_C EF-hand_10 Motif Other DBs NCBI-GeneID:  116315716 NCBI-ProteinID:  XP_031589962 UniProt:  A0AAZ1X3A2 LinkDB All DBs Position LG11:20803463..20804776 Genome browser AA seq 96 aa AA seqDB search MTDLEKSMESMITVFNKYAHDGKHGKALTKKELRKLIEAELPNFLKTQKNPNTVDNIMKD LDHSKDDVLDFEEFMPFIAGLTMACEKYCSMSAKKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgactgacttggagaaatccatggagtccatgataaccgtgttcaacaagtatgcccat gatggcaaacatggaaaggccttaacaaagaaagaactaagaaaactaattgaggctgag cttcccaacttcctgaaaacgcagaagaatcccaacaccgtggacaatatcatgaaggat ctggaccacagcaaagatgatgtcttggactttgaagaatttatgccattcatcgccggc ctcacaatggcctgtgaaaaatattgctccatgagtgctaaaaagaagtga

DBGET integrated database retrieval system