Oreochromis aureus (blue tilapia): 116324083 Help Entry 116324083         CDS       T07295                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism oau  Oreochromis aureus (blue tilapia) Pathway oau03082   ATP-dependent chromatin remodeling oau04217   Necroptosis Brite KEGG Orthology (KO) [BR:oau00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     116324083  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     116324083  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oau03036]     116324083   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oau04147]     116324083 Chromosome and associated proteins [BR:oau03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116324083 Exosome [BR:oau04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116324083 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  116324083 NCBI-ProteinID:  XP_031600486 Ensembl:  ENSOABG00000006129 UniProt:  A0AAZ1XI25 LinkDB All DBs Position LG10:6649613..6650477 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPTKSK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggcagaggaaagaccggaggcaaagcccgagcaaaggccaagtcccgctcctct cgagccggactccagttcccagtgggtcgagtccacaggctgctgcgcaaaggaaactac gcggagcgggtcggcgccggggctcccgtgtacctggcggccgtgctggagtatctgact gctgagattttggagctcgcagggaatgcagccagggacaacaagaagaccagaatcatt ccccggcacctccagctggcagtacgaaacgacgaggagctcaacaagctgctgggggga gtgaccattgcccaaggaggagtgctgcccaacattcaggctgtcctccttcccaagaag acggagaaaccgactaagagcaagtaa

DBGET integrated database retrieval system