Oreochromis aureus (blue tilapia): 116326663 Help Entry 116326663         CDS       T07295                                  Name (RefSeq) C-Myc-binding protein   KO K25550   c-Myc-binding protein Organism oau  Oreochromis aureus (blue tilapia) Brite KEGG Orthology (KO) [BR:oau00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oau03037]     116326663 Cilium and associated proteins [BR:oau03037]  Motile cilia and associated proteins   Sperm associated proteins    116326663 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TSC22 GOLGA2L5 ZapB Syntaxin_2 DivIC CC149 K-box bZIP_1 YabA GIT_CC ATG16 HAP1_N bZIP_2 RasGAP_C CLZ Motif Other DBs NCBI-GeneID:  116326663 NCBI-ProteinID:  XP_031603887 Ensembl:  ENSOABG00000023304 UniProt:  A0A668VL61 LinkDB All DBs Position LG22:complement(29064086..29066523) Genome browser AA seq 103 aa AA seqDB search MAQYRASESKREQFRRYLEKSGVLDTLTSVLVALYEEPEKPNNALDFIKLHLGAAGPEPA DTEALRTELADLQQKYNELMEENKELRSKLMQYEPSPDGEAAE NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggctcaatatagagcctctgagtcgaagcgggaacaatttagaagatacctcgaaaaa tctggagtcctcgacaccttaacaagcgttttagttgctctttatgaggagcctgagaaa cctaacaatgccctggatttcataaagcttcatcttggggcagctggtccagagccagca gacacagaggctcttcgtacagagctggctgatctacaacagaaatacaacgagctcatg gaggagaacaaagagctgaggagcaagctgatgcagtatgaaccgtcgcctgatggggaa gcagcagagtag

DBGET integrated database retrieval system