KEGG Orthology (KO) [BR:oau00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04120 Ubiquitin mediated proteolysis
116328832 (elob)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04121 Ubiquitin system [BR:oau04121]
116328832 (elob)
03400 DNA repair and recombination proteins [BR:oau03400]
116328832 (elob)
Ubiquitin system [BR:oau04121]
Ubiquitin ligases (E3)
Multi subunit type E3
Cul2 complex
Adoptor protein
116328832 (elob)
Cul5 complex
116328832 (elob)
DNA repair and recombination proteins [BR:oau03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
Other NER factors
116328832 (elob)
153 aa
MVELKLWLPDAALSSQLSLCSAVFLPTVCSQPQDMDVFLMIRRHKTTIFTDAKESTTVYE
LKRIVEGILKRPPEDQRLYKDDVLLNDSQTLGNCGFTNQTARPQAPATVGLAFRLSDDSF
EQLRIEPFSTPPELPDVMKPQDSGSTANEQAVQ