Oreochromis aureus (blue tilapia): 116329500 Help Entry 116329500         CDS       T07295                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism oau  Oreochromis aureus (blue tilapia) Pathway oau03030   DNA replication oau03410   Base excision repair oau03420   Nucleotide excision repair oau03430   Mismatch repair oau03440   Homologous recombination Brite KEGG Orthology (KO) [BR:oau00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     116329500 (pold4)    03410 Base excision repair     116329500 (pold4)    03420 Nucleotide excision repair     116329500 (pold4)    03430 Mismatch repair     116329500 (pold4)    03440 Homologous recombination     116329500 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:oau03032]     116329500 (pold4)    03400 DNA repair and recombination proteins [BR:oau03400]     116329500 (pold4) DNA replication proteins [BR:oau03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     116329500 (pold4) DNA repair and recombination proteins [BR:oau03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       116329500 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      116329500 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  116329500 NCBI-ProteinID:  XP_031607383 Ensembl:  ENSOABG00000014080 LinkDB All DBs Position LG6:complement(3290590..3300225) Genome browser AA seq 107 aa AA seqDB search MTTKRRLITDSFKVVKRSRKGGKREKSPTPPPSPQKEADRIREEELEKLRQFDLDWSFGP CTGISRLQRWERAKLHGLNPPEEIRDLLLQTHADPEYNLSLWSGYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgacaaccaagcgcagacttatcacggactcattcaaagtggtgaagagatccagaaaa ggagggaagcgagagaagagccccactcctcctccttccccacagaaagaggctgacaga attagagaggaggaactggagaagctccgacagtttgacctcgactggagttttgggcct tgcacaggtatcagcaggctgcagaggtgggagagagcaaagcttcatggtctgaaccca cctgaggagatcagagacctgctgctgcaaacccacgccgacccagagtacaacctgagc ttgtggagtggatatcctctctga

DBGET integrated database retrieval system