Oreochromis aureus (blue tilapia): 116333285 Help Entry 116333285         CDS       T07295                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism oau  Oreochromis aureus (blue tilapia) Pathway oau04010   MAPK signaling pathway oau04012   ErbB signaling pathway oau04068   FoxO signaling pathway oau04137   Mitophagy - animal oau04140   Autophagy - animal oau04144   Endocytosis oau04150   mTOR signaling pathway oau04210   Apoptosis oau04218   Cellular senescence oau04370   VEGF signaling pathway oau04371   Apelin signaling pathway oau04510   Focal adhesion oau04540   Gap junction oau04625   C-type lectin receptor signaling pathway oau04810   Regulation of actin cytoskeleton oau04910   Insulin signaling pathway oau04912   GnRH signaling pathway oau04916   Melanogenesis oau05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oau00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116333285    04012 ErbB signaling pathway     116333285    04370 VEGF signaling pathway     116333285    04371 Apelin signaling pathway     116333285    04068 FoxO signaling pathway     116333285    04150 mTOR signaling pathway     116333285  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116333285    04140 Autophagy - animal     116333285    04137 Mitophagy - animal     116333285   09143 Cell growth and death    04210 Apoptosis     116333285    04218 Cellular senescence     116333285   09144 Cellular community - eukaryotes    04510 Focal adhesion     116333285    04540 Gap junction     116333285   09142 Cell motility    04810 Regulation of actin cytoskeleton     116333285  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116333285   09152 Endocrine system    04910 Insulin signaling pathway     116333285    04912 GnRH signaling pathway     116333285    04916 Melanogenesis     116333285  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116333285  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oau04131]     116333285   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oau04147]     116333285    04031 GTP-binding proteins [BR:oau04031]     116333285 Membrane trafficking [BR:oau04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     116333285  Endocytosis   Macropinocytosis    Ras GTPases     116333285 Exosome [BR:oau04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    116333285   Exosomal proteins of colorectal cancer cells    116333285 GTP-binding proteins [BR:oau04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     116333285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  116333285 NCBI-ProteinID:  XP_031612343 Ensembl:  ENSOABG00000002492 LinkDB All DBs Position LG7:complement(6069909..6084473) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggagctggaggcgtgggcaagagtgcacttacc atacagctgatccagaaccactttgtggatgaatatgaccccacaatagaggactcatac aggaagcaggttgtgatagacggggagacctgcctgttggacatcctggacactgcaggt caagaggagtacagcgccatgagggatcagtacatgaggacgggagagggcttcctgtgt gtcttcgccatcaacaataccaagtcttttgaggacattcaccagtatagagaacagatt aaacgtgttaaggactccgatgatgttcccatggtgcttgtgggaaacaaatgtgacctc cctgcacgcacggtggacacgaggcaagcccaggagctcgctcgctcctatggcatcccc tacattgagacctctgccaaaacacgacagggagtagaggacgccttctacacactggtt agagagatcaggcagcataagttgaggaagttgaacccacccgatgagagtggtcaagac tgtatgagctgtcgctgtgtggtgtcgtga

DBGET integrated database retrieval system