Oreochromis aureus (blue tilapia): 116333814 Help Entry 116333814         CDS       T07295                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism oau  Oreochromis aureus (blue tilapia) Pathway oau04137   Mitophagy - animal oau04140   Autophagy - animal oau04144   Endocytosis oau04145   Phagosome oau04148   Efferocytosis oau05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oau00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116333814    04145 Phagosome     116333814    04140 Autophagy - animal     116333814    04137 Mitophagy - animal     116333814    04148 Efferocytosis     116333814  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116333814  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oau04131]     116333814   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oau04147]     116333814    04031 GTP-binding proteins [BR:oau04031]     116333814 Membrane trafficking [BR:oau04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     116333814 Exosome [BR:oau04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116333814   Exosomal proteins of other body fluids (saliva and urine)    116333814   Exosomal proteins of colorectal cancer cells    116333814   Exosomal proteins of bladder cancer cells    116333814 GTP-binding proteins [BR:oau04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     116333814 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 AAA_16 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 SRPRB NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  116333814 NCBI-ProteinID:  XP_031612940 Ensembl:  ENSOABG00000010952 LinkDB All DBs Position LG5:18589826..18598597 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNDFPGPIKLGGNEGPKPATESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgctcctgaaagtcatcatcctgggagattcaggtgttggg aagacctccttaatgaaccagtatgtgaacaagaagtttagtaaccagtacaaagccaca ataggagcagacttcctgacgaaggaggtgatggtggatgaccgactcgttacaatgcag atctgggacacagctggccaggagaggttccagtctttgggtgttgcattctaccgtgga gcagactgctgtgtgctggtgtttgatgttactgcacccaatacattcaaaacacttgac agctggagggatgagtttctgatccaggccagtcctcgagatcctgagaacttcccgttt gtggtgctaggcaacaagattgacttggagaacagacaggtgaccaccaaaagggctcag gcctggtgtcaaagtaagaacaacatcccctactttgagaccagtgcgaaggaagccata aatgtcgaacaggcattccagacaatcgcacgtaacgcactcaaacaggagacagaggtg gagttgtataatgacttcccagggcccataaagctgggagggaatgaaggacctaaaccc gcaacagaaagctgcagttgctaa

DBGET integrated database retrieval system