Oreochromis aureus (blue tilapia): 116334262 Help Entry 116334262         CDS       T07295                                  Symbol cenps Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism oau  Oreochromis aureus (blue tilapia) Pathway oau03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:oau00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     116334262 (cenps)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oau03036]     116334262 (cenps)    03400 DNA repair and recombination proteins [BR:oau03400]     116334262 (cenps) Chromosome and associated proteins [BR:oau03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      116334262 (cenps) DNA repair and recombination proteins [BR:oau03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      116334262 (cenps) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone DUF7229 Bromo_TP Serine_rich TFIID-31kDa Motif Other DBs NCBI-GeneID:  116334262 NCBI-ProteinID:  XP_031613506 Ensembl:  ENSOABG00000023403 LinkDB All DBs Position LG5:complement(24698532..24702935) Genome browser AA seq 122 aa AA seqDB search MSVDTEETHQRLKAAVHYTVGRLCQKIGEDHRRQFSRQAIAAIAETTFRQCDIFAKDLEA FARHAKRSTVSVDDVKLVARRSTALSIYIQNKSDELTQEHMSLKKKTTAKRKNIETEEES RE NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtcagtggatacagaggaaactcaccagaggttaaaagctgcagttcattatacagtg ggtcgtctctgccagaagatcggtgaagaccaccggagacagttcagccgacaagctata gcggcaatagccgagacgacattcagacagtgtgatatatttgcaaaagacctggaggct tttgcaaggcatgctaaaagaagcaccgtgtctgtagatgatgtgaaacttgtagcccgc cgcagtactgctttgtccatctacatacaaaataaaagtgacgaactgacccaggagcac atgagtttaaaaaagaagactactgcaaagagaaagaacatagaaactgaggaggaaagc agagaataa

DBGET integrated database retrieval system