Oreochromis aureus (blue tilapia): 116335118 Help Entry 116335118         CDS       T07295                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism oau  Oreochromis aureus (blue tilapia) Pathway oau04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:oau00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     116335118  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:oau04121]     116335118    03400 DNA repair and recombination proteins [BR:oau03400]     116335118 Ubiquitin system [BR:oau04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      116335118    Cul5 complex      116335118 DNA repair and recombination proteins [BR:oau03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      116335118 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  116335118 NCBI-ProteinID:  XP_031614585 Ensembl:  ENSOABG00000024412 UniProt:  A0AAZ1XKA2 LinkDB All DBs Position LG8 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLEDSKTLGDS GFTNQTARPQAPATVGLAFRINDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagaccacaatcttcaccgatgccaaggag tccaccactgtctatgagctgaagcgtattgtcgagggaatacttaaaagaccacccgag gaccaacgactctacaaagatgatcagctgctagaggatagcaaaactctgggtgactct ggattcaccaaccagactgccagacctcaagccccagctacagtcggtctggcatttcgt attaatgatgagatgtttgagcagctgcacatcgaggccttttccagccccccggaactc cctgatgtgatgaagcctcaggactctggtagcactgctaatgaacaggcagtgcagtga

DBGET integrated database retrieval system