Oreochromis aureus (blue tilapia): 116335737 Help Entry 116335737         CDS       T07295                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism oau  Oreochromis aureus (blue tilapia) Pathway oau04010   MAPK signaling pathway oau04068   FoxO signaling pathway oau04081   Hormone signaling oau04114   Oocyte meiosis oau04140   Autophagy - animal oau04150   mTOR signaling pathway oau04810   Regulation of actin cytoskeleton oau04910   Insulin signaling pathway oau04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:oau00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116335737 (ins)    04068 FoxO signaling pathway     116335737 (ins)    04150 mTOR signaling pathway     116335737 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     116335737 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116335737 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     116335737 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116335737 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     116335737 (ins)    04914 Progesterone-mediated oocyte maturation     116335737 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oau04052]     116335737 (ins) Cytokines and neuropeptides [BR:oau04052]  Neuropeptides   Unclassified    116335737 (ins) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  116335737 NCBI-ProteinID:  XP_031615350 LinkDB All DBs Position LG10:complement(33096301..33097674) Genome browser AA seq 113 aa AA seqDB search MAALWLQTFSLLVLMMVSWPGSQAVGGPQHLCGSHLVDALYLVCGDRGFFYNPRRDVDPL LGFLPPKAGGAVVQGGENEVTFKDQMEMMVKRGIVEECCHKPCTIFDLQNYCN NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcagcgctctggctccagaccttctccctgctcgtcttaatgatggtttcgtggccg ggctcccaggccgtcggtgggccacagcacctgtgcggctcccacctggtggacgccctg tacctggtctgtggggacagaggcttcttctacaaccccaggagagatgtggaccctctg cttggtttcctccctccaaaggcaggtggtgctgtggtgcaaggtggtgagaatgaagtg accttcaaagaccagatggaaatgatggtgaagcgaggcattgtggaggaatgctgtcac aaaccctgtaccatcttcgacctgcagaactactgcaactga

DBGET integrated database retrieval system