Oreochromis aureus (blue tilapia): 120439103 Help Entry 120439103         CDS       T07295                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism oau  Oreochromis aureus (blue tilapia) Pathway oau04060   Cytokine-cytokine receptor interaction oau04218   Cellular senescence oau04620   Toll-like receptor signaling pathway oau04621   NOD-like receptor signaling pathway oau04622   RIG-I-like receptor signaling pathway oau05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oau00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120439103  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     120439103  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120439103    04621 NOD-like receptor signaling pathway     120439103    04622 RIG-I-like receptor signaling pathway     120439103  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120439103  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oau04052]     120439103    00536 Glycosaminoglycan binding proteins [BR:oau00536]     120439103 Cytokines and neuropeptides [BR:oau04052]  Cytokines   Chemokines    120439103 Glycosaminoglycan binding proteins [BR:oau00536]  Heparan sulfate / Heparin   Chemokines    120439103 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  120439103 NCBI-ProteinID:  XP_039465750 UniProt:  A0AAZ1X2L3 LinkDB All DBs Position LG3:27872009..27874927 Genome browser AA seq 122 aa AA seqDB search MTFEVNASLIDVFKFISKFTGGEKEKMKLFAVKCVLTTGMPPISRDYNTHCRCLQVESRI IPPDNLRSIKLFPEGPHCPDTEVIAGLANGAKVCLNPHSTWVKKLIFFLEKQQLGKASKK RA NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgacctttgaagtaaacgcaagcttgattgatgtcttcaagtttatatccaagttcaca ggaggtgagaaagaaaagatgaagctgtttgctgttaaatgtgtgctgacgacaggtatg ccgccaatcagccgtgactacaacacccactgccggtgcctgcaggtggagtcgaggatc atccctccagacaacctgaggagcatcaaactgttccctgaggggcctcactgcccagac acagaagtcatagctggactggcaaacggagcaaaggtttgtctgaaccctcattccacc tgggtgaagaagctgatcttctttctggagaaacagcagttgggaaaggcctccaagaaa cgggcataa

DBGET integrated database retrieval system