Oreochromis aureus (blue tilapia): 120441868 Help Entry 120441868         CDS       T07295                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism oau  Oreochromis aureus (blue tilapia) Brite KEGG Orthology (KO) [BR:oau00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:oau01002]     120441868   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oau04147]     120441868 Peptidases and inhibitors [BR:oau01002]  Peptidase inhibitors   Family I25: cystatin family    120441868 Exosome [BR:oau04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    120441868 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Cas10-Cmr2_palm2 Man-6-P_recep Motif Other DBs NCBI-GeneID:  120441868 NCBI-ProteinID:  XP_039473278 LinkDB All DBs Position LG9:18559565..18564018 Genome browser AA seq 97 aa AA seqDB search MCGGLTEVKQADEEVQNICDAMKPLAEQKTGRNFEVFTAKSYKTQLVAGTNYFIKVYVGG DDYVHLRVYEKLPCDGGTLELTDLQHPKSQHDSIEYF NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtgcggagggctgaccgaggtgaagcaggctgatgaagaagttcagaacatctgtgat gcaatgaaacctctcgcagagcagaaaactgggagaaacttcgaggttttcactgcaaag agctacaaaacacagctcgtagctgggaccaactacttcattaaggtctatgtgggagga gacgattatgttcacctccgtgtttacgagaaactcccgtgtgatggaggaacgctcgag ctgaccgatctgcagcaccccaagagtcaacatgacagtattgagtacttctaa

DBGET integrated database retrieval system