Oreochromis aureus (blue tilapia): 120442172 Help Entry 120442172         CDS       T07295                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism oau  Oreochromis aureus (blue tilapia) Pathway oau03272   Virion - Hepatitis viruses oau04382   Cornified envelope formation oau04514   Cell adhesion molecules oau04530   Tight junction Brite KEGG Orthology (KO) [BR:oau00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     120442172  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     120442172  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     120442172  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     120442172  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oau03037]     120442172    04147 Exosome [BR:oau04147]     120442172    04515 Cell adhesion molecules [BR:oau04515]     120442172 Cilium and associated proteins [BR:oau03037]  Other cilia and associated proteins   Stereociliary proteins    120442172 Exosome [BR:oau04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    120442172   Exosomal proteins of colorectal cancer cells    120442172 Cell adhesion molecules [BR:oau04515]  Immunoglobulin superfamily   L1 family    120442172 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF308 DUF6223 MFS_MOT1 Prominin Motif Other DBs NCBI-GeneID:  120442172 NCBI-ProteinID:  XP_039473948 LinkDB All DBs Position LG10:complement(19498295..19498877) Genome browser AA seq 125 aa AA seqDB search MCLMWDTGKMECEIYLDFAMMPEAMNAARALVIIAIIVGVFGILLGVTGNKRTNFMSDDG QKSKVAFGSGLLFIIAGFLVLTPVCWIANISVRESYKMDRQVSSMNPGASLYIGWFTAGL LFPQE NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgtgtctaatgtgggatacaggcaagatggaatgcgaaatatatttggattttgctatg atgcctgaagccatgaatgctgccagagcgctcgtcattatcgcgatcatcgttggggtc tttgggatcctgcttggcgtgaccggcaacaagcgcactaacttcatgtcagatgacggg caaaagagcaaagtggcctttggttctggacttctcttcatcatcgcaggtttcctggtg cttacacctgtctgctggatcgccaacatctctgttcgtgagtcatacaaaatggacaga caggtttccagcatgaatcctggagcctcactctacatcggctggttcactgctgggctt ctgttcccgcaagaatga

DBGET integrated database retrieval system