Congregicoccus parvus: ASA1KI_25630 Help Entry ASA1KI_25630      CDS       T10563                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism oba  Congregicoccus parvus Pathway oba03430   Mismatch repair Brite KEGG Orthology (KO) [BR:oba00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     ASA1KI_25630  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:oba03400]     ASA1KI_25630 Enzymes [BR:oba01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      ASA1KI_25630 DNA repair and recombination proteins [BR:oba03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      ASA1KI_25630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S DUF5830 KxDL A-ATP_synth_H_N Motif Other DBs NCBI-ProteinID:  BET67645 LinkDB All DBs Position complement(3233277..3233519) Genome browser AA seq 80 aa AA seqDB search MKATQESKLPFEQALAELEELVARIETGDIPLSDLVDRFERGTKLLNVCTKRLADAELKI QLLQKDRRTIAFEALAPDTD NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgaaagctacgcaagagagcaagctgccgttcgaacaggcactcgccgagttggaggag ttggtcgcccgcatcgagaccggtgacatccctctctcggatctcgtcgatcggttcgag cgaggcacgaaactgctcaacgtctgcaccaaacgccttgcggatgccgaactgaagatc caactcctgcaaaaggaccggagaaccatcgccttcgaggctctcgctccggataccgat tag

DBGET integrated database retrieval system