Osmia bicornis bicornis (red mason bee): 114874314 Help Entry 114874314         CDS       T06109                                  Name (RefSeq) eclosion hormone   KO K28249   eclosion hormone Organism obb  Osmia bicornis bicornis (red mason bee) Brite KEGG Orthology (KO) [BR:obb00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:obb04052]     114874314 Cytokines and neuropeptides [BR:obb04052]  Neuropeptides   Unclassified    114874314 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Eclosion Motif Other DBs NCBI-GeneID:  114874314 NCBI-ProteinID:  XP_029039326 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MNTSTRILLVLFVAYATVFVLAAGNTPFDRAIGVCIRNCAQCKKMFGPYFLGQKCADSCV KYKGKLIPDCEDEVSIQPFLQALDSEY NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaatacatcaactcgcattctcctggtgctcttcgtagcctatgccacggtcttcgtg ctcgctgcgggaaacactcctttcgatcgagccataggcgtttgcatcagaaactgtgcc cagtgcaagaaaatgttcggaccgtacttcctgggccagaaatgcgccgattcctgcgtg aagtacaaaggaaagctcatccccgactgcgaggatgaggtttcgattcaaccgttcctc caggctctcgatagcgaatattga

DBGET integrated database retrieval system