Osmia bicornis bicornis (red mason bee): 114874804 Help Entry 114874804         CDS       T06109                                  Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism obb  Osmia bicornis bicornis (red mason bee) Brite KEGG Orthology (KO) [BR:obb00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:obb03037]     114874804 Cilium and associated proteins [BR:obb03037]  Primary cilia and associated proteins   BBSome    114874804 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  114874804 NCBI-ProteinID:  XP_029040259 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MSELINDSTEKIDIILPRQGFLYQEENLDYILCKPKLIPLKSVTLEKLEKMQKDAELKIR ETMEEQAKINDNE NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgtcagagttgataaacgattctacagagaagattgatataattcttcctagacaaggt ttcctatatcaggaagaaaatttagattatatactttgcaaacccaagttaattccatta aagtcagttaccttagaaaaattagaaaagatgcaaaaggatgctgagttaaaaatccgg gaaactatggaagaacaagctaaaataaatgataatgagtag

DBGET integrated database retrieval system