Osmia bicornis bicornis (red mason bee): 114877497 Help Entry 114877497         CDS       T06109                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism obb  Osmia bicornis bicornis (red mason bee) Pathway obb04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:obb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114877497  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:obb04121]     114877497    03400 DNA repair and recombination proteins [BR:obb03400]     114877497 Ubiquitin system [BR:obb04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      114877497    Cul5 complex      114877497 DNA repair and recombination proteins [BR:obb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      114877497 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  114877497 NCBI-ProteinID:  XP_029045993 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MDVFLMIRRKNMTIFTDAKDNTTVLELKKIIEGILKISPVNQQLFNKDNVAMTDSKFLSD YGLTSATAKAQCPALVGLAVRQENGQFEPLEMTPFSLPPDLPDVMKSQESNSQDQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttctaatgattcgacgaaagaatatgacgatatttactgatgcaaaagat aatactacagttctcgaacttaagaaaattatagaaggtatattaaaaatatcacctgtg aatcagcagcttttcaacaaagataatgttgcaatgacagatagtaaatttttatctgat tatggattaacatctgcaactgccaaagcacagtgtcctgcgttagtaggattagctgta cgccaagaaaatggtcaatttgaacctttagagatgactccattttcattaccacctgac ctaccagatgtgatgaaatctcaagaatccaatagccaagatcagtcgccttga

DBGET integrated database retrieval system